Record in detail


General Info

  • lamp_id:L05ADEF500
  • Name:B7XFT1_IXOPE
  • FullName:
  • Source:Ixodes persulcatus
  • Mass:4199.8 Da
  • Sequence Length:38 aa
  • Isoelectric Point:9.18
  • Activity:Antimicrobial
  • Sequence
        GFGCPFNQGACHRHCRSIGRRGGYCAGLFKQTCTCYSR
  • Function:null

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  8092
  •   2  Database:dbAMP  dbAMP_02548
  •   3  Database:DRAMP  DRAMP04492
  •   4  Database:Uniprot  B7XFT1
  •   5  Database:DEF  DEF500

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05ADEF500    From 1 To 38 E-value: 4e-17 Score: 78.2
        GFGCPFNQGACHRHCRSIGRRGGYCAGLFKQTCTCYSR
  • 2. L01A000594    From 1 To 36 E-value: 0.000000000000003 Score: 72.4
        GFGCPFNQGACHRHCRSIRRRGGYCAGLFKQTCTCY
  • 3. L05ADEF518    From 1 To 36 E-value: 0.000000000000004 Score: 71.6
        GFGCPFNQGACHRHCQSIGRKGGYCSGLFKQTCTCY
  • 4. L05ADEF394    From 15 To 52 E-value: 0.000000000000005 Score: 71.2
        GFGCPLNQGACHNHCRSIGRRGGYCAGIIKQTCTCYRK
  • 5. L01A000718    From 1 To 36 E-value: 0.000000000000008 Score: 70.9
        GFGCPFNQGACHRHCRSIRRRGGYCAGLIKQTCTCY

Structure

  •   Domains
  •   1  Name:Defensin_invertebrate/fungal    Interpro Link:IPR001542
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Nishikado H.,Imamura S.,Yamada S.,Konnai S.,Saito Y.,
  •   Title:Identification and characterization of antimicrobial peptide, defensin, in the taiga tick, Ixodes persulcatus.
  •   Journal:Insect Mol. Biol., 2009, 18, 531-539  [:]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: