Record in detail


General Info

  • lamp_id:L05ADEF505
  • Name:A8RJ19_CULQU
  • FullName:
  • Source:Culex quinquefasciatus
  • Mass:9894.4 Da
  • Sequence Length:94 aa
  • Isoelectric Point:8.72
  • Activity:Antimicrobial
  • Sequence
        PFVDGPLCTPGKVTRPQGLVESIVGTTTGDDAPPNFSAAVVVRRNIFCRNFGTARGCYGTAHPLPRMLSCVPPKGGVFCPLVAANTHRLHCCSN
  • Function:null

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  A8RJ19
  •   2  Database:DEF  DEF505

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05ADEF505    From 1 To 94 E-value: 0 Score: 190
        PFVDGPLCTPGKVTRPQGLVESIVGTTTGDDAPPNFSAAVVVRRNIFCRNFGTARGCYGTAHPLPRMLSCVPPKGGVFCPLVAANTHRLHCCSN
  • 2. L12A05629|    From 18 To 46 E-value: 5.6 Score: 21.6
        GNEVEASRILSDITAFGGIRCPLTVVQSR
  • 3. L13A010489    From 18 To 46 E-value: 5.8 Score: 21.6
        GNEVEASRILSDITAFGGIRCPLTVVQSR
  • 4. L12A05628|    From 18 To 46 E-value: 6.2 Score: 21.2
        GNEVEASRILSDITAFGGIRCPLTVVQSR
  • 5. L01A002628    From 37 To 53 E-value: 8 Score: 20.8
        RGGYYCPFFQDKCHR-HC

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Paily K.P.,Kumar B.A.,
  •   Title:Identification of immune-responsive genes in the mosquito Culex quinquefasciatus infected with the filarial parasite Wuchereria bancrofti.
  •   Journal:Med. Vet. Entomol., 2008, 22, 394-398  [:]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: