Record in detail


General Info

  • lamp_id:L05ADEF512
  • Name:A0F088_AMBAM
  • FullName:
  • Source:Amblyomma americanum
  • Mass:4054.5 Da
  • Sequence Length:37 aa
  • Isoelectric Point:8.38
  • Activity:Antimicrobial
  • Sequence
        GFGCPFNQYQCHSHCLSIGRRGGYCGGSFKTTCTCYN
  • Function:null

Cross-Linking

  •   Cross-linking
  •   1  Database:DRAMP  DRAMP04493
  •   2  Database:Uniprot  A0F088
  •   3  Database:DEF  DEF512

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05ADEF512    From 1 To 37 E-value: 1e-16 Score: 76.6
        GFGCPFNQYQCHSHCLSIGRRGGYCGGSFKTTCTCYN
  • 2. L02A000539    From 1 To 37 E-value: 0.000000000003 Score: 62
        GFGCPWNRYQCHSHCRSIGRLGGYCAGSLRLTCTCYR
  • 3. L05ADEF500    From 1 To 37 E-value: 0.000000000009 Score: 60.5
        GFGCPFNQGACHRHCRSIGRRGGYCAGLFKQTCTCYS
  • 4. L05ADEF394    From 15 To 51 E-value: 0.00000000002 Score: 59.3
        GFGCPLNQGACHNHCRSIGRRGGYCAGIIKQTCTCYR
  • 5. L05ADEF518    From 1 To 37 E-value: 0.00000000004 Score: 58.5
        GFGCPFNQGACHRHCQSIGRKGGYCSGLFKQTCTCYR

Structure

  •   Domains
  •   1  Name:Defensin_invertebrate/fungal    Interpro Link:IPR001542
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Hynes W.L.,Sonenshine D.E.,Todd S.M.,
  •   Title:Tissue and life-stage distribution of a defensin gene in the Lone Star tick, Amblyomma americanum.
  •   Journal:Med. Vet. Entomol., 2007, 21, 141-147  [PubMed:17550433]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: