Record in detail


General Info

  • lamp_id:L05ADEF518
  • Name:Q09JJ7_ARGMO
  • FullName:
  • Source:Argas monolakensis
  • Mass:4209.8 Da
  • Sequence Length:38 aa
  • Isoelectric Point:8.87
  • Activity:Antimicrobial
  • Sequence
        GFGCPFNQGACHRHCQSIGRKGGYCSGLFKQTCTCYRH
  • Function:null

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  Q09JJ7
  •   2  Database:DEF  DEF518

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05ADEF518    From 1 To 38 E-value: 3e-17 Score: 79
        GFGCPFNQGACHRHCQSIGRKGGYCSGLFKQTCTCYRH
  • 2. L05ADEF500    From 1 To 36 E-value: 0.000000000000004 Score: 71.6
        GFGCPFNQGACHRHCRSIGRRGGYCAGLFKQTCTCY
  • 3. L01A000594    From 1 To 37 E-value: 0.000000000000007 Score: 70.9
        GFGCPFNQGACHRHCRSIRRRGGYCAGLFKQTCTCYR
  • 4. L12A01314|    From 14 To 51 E-value: 0.00000000000001 Score: 70.5
        GFGCPLNQGACHRHCRSIRRRGGYCSGIIKQTCTCYRN
  • 5. L01A000718    From 1 To 38 E-value: 0.00000000000002 Score: 69.7
        GFGCPFNQGACHRHCRSIRRRGGYCAGLIKQTCTCYRN

Structure

  •   Domains
  •   1  Name:Defensin_invertebrate/fungal    Interpro Link:IPR001542
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Schwan T.G.,Valenzuela J.G.,Francischetti I.M.,Andersen J.F.,Mans B.J.,
  •   Title:Comparative sialomics between hard and soft ticks: implications for the evolution of blood-feeding behavior.
  •   Journal:Insect Biochem. Mol. Biol., 2008, 38, 42-58  [PubMed:18070664]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: