Record in detail


General Info

  • lamp_id:L05ADEF520
  • Name:Q09JE4_ARGMO
  • FullName:
  • Source:Argas monolakensis
  • Mass:4183.7 Da
  • Sequence Length:37 aa
  • Isoelectric Point:7.76
  • Activity:Antimicrobial
  • Sequence
        DYGCPVFQIECQQHCSATFGWQGRCGGSRRSECICRN
  • Function:null

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  Q09JE4
  •   2  Database:DEF  DEF520

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05ADEF520    From 1 To 37 E-value: 3e-17 Score: 78.6
        DYGCPVFQIECQQHCSATFGWQGRCGGSRRSECICRN
  • 2. L05ADEF517    From 42 To 77 E-value: 0.00000001 Score: 50.4
        YGCPDDYSRCQQHCSATFGWTGWCGGVTRGECKCRE
  • 3. L05ADEF513    From 5 To 39 E-value: 0.002 Score: 33.1
        FGCPIDEGKCFDHCNNKAYDGGYCGGSYRATCICH
  • 4. L01A002628    From 40 To 73 E-value: 0.002 Score: 32.7
        YYCPFFQDKCHRHCRSFGRKAGYCGGFLKKTCIC
  • 5. L05ADEF512    From 2 To 37 E-value: 0.002 Score: 32.7
        FGCPFNQYQCHSHCLSIGRRGGYCGGSFKTTCTCYN

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Schwan T.G.,Valenzuela J.G.,Francischetti I.M.,Andersen J.F.,Mans B.J.,
  •   Title:Comparative sialomics between hard and soft ticks: implications for the evolution of blood-feeding behavior.
  •   Journal:Insect Biochem. Mol. Biol., 2008, 38, 42-58  [PubMed:18070664]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: