Record in detail


General Info

  • lamp_id:L05ADEF540
  • Name:Q7Z0G6_SPOFR
  • FullName:
  • Source:Spodoptera frugiperda
  • Mass:3955.4 Da
  • Sequence Length:36 aa
  • Isoelectric Point:4.1
  • Activity:Antimicrobial
  • Sequence
        VSCDFEEANEDAVCQEHCLPKGYTYGICVSHTCSCI
  • Function:null

Cross-Linking

  •   Cross-linking
  •   1  Database:DRAMP  DRAMP04474
  •   2  Database:Uniprot  Q7Z0G6
  •   3  Database:DEF  DEF540

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L13A019158    From 1 To 36 E-value: 1e-16 Score: 77
        VSCDFEEANEDAVCQEHCLPKGYTYGICVSHTCSCI
  • 2. L05ADEF540    From 1 To 36 E-value: 2e-16 Score: 75.9
        VSCDFEEANEDAVCQEHCLPKGYTYGICVSHTCSCI
  • 3. L05ADEF405    From 1 To 36 E-value: 0.0000000000009 Score: 63.9
        IWCEFEEATETAICQEHCLPKGYSYGICVSNTCSCI
  • 4. L05ADEF542    From 64 To 99 E-value: 0.000000000003 Score: 62
        IWCQYEEVTEDAICQEHCIPKGYSYGLCISNTCSCI
  • 5. L11A009743    From 2 To 37 E-value: 0.00000000003 Score: 58.9
        IPCQYEDATEDTICQQHCLPKGYSYGICVSYRCSCV

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Landais I.,Bouton M.,d"Alencon E.,Rocher J.,Volkoff A.N.,
  •   Title:Characterization and transcriptional profiles of three Spodoptera frugiperda genes encoding cysteine-rich peptides. A new class of defensin-like genes from lepidopteran insects?
  •   Journal:Gene, 2003, 319, 43-53  [MEDLINE:22959633]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: