Record in detail


General Info

  • lamp_id:L05ADEF545
  • Name:A8CWF7_LUTLO
  • FullName:
  • Source:Lutzomyia longipalpis
  • Mass:4090.7 Da
  • Sequence Length:39 aa
  • Isoelectric Point:8.12
  • Activity:Antimicrobial
  • Sequence
        VTCDLLGPTGWGDALCAAHCISKGYRGGYCNAQKVCVCR
  • Function:null

Cross-Linking

  •   Cross-linking
  •   1  Database:DRAMP  DRAMP04475
  •   2  Database:Uniprot  A8CWF7
  •   3  Database:DEF  DEF545

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05ADEF545    From 1 To 39 E-value: 4e-18 Score: 81.6
        VTCDLLGPTGWGDALCAAHCISKGYRGGYCNAQKVCVCR
  • 2. L01A002933    From 1 To 39 E-value: 0.00000000001 Score: 60.5
        ATCDLLSGFGVGDSACAAHCIARGNRGGYCNSQKVCVCR
  • 3. L03A000168    From 60 To 97 E-value: 0.00000000001 Score: 60.5
        TCDLLSGFGVGDSACAAHCIARGNRGGYCNSKKVCVCR
  • 4. L01A000505    From 1 To 39 E-value: 0.00000000003 Score: 58.9
        ATCDLLSGFGVGDSACAAHCIARGNRGGYCNSKKVCVCR
  • 5. L12A09253|    From 61 To 98 E-value: 0.00000000004 Score: 58.5
        TCDLLSGFGVGDSACAAHCIARRNRGGYCNAKKVCVCR

Structure

  •   Domains
  •   1  Name:Defensin_invertebrate/fungal    Interpro Link:IPR001542
  •   2  Name:Knot1    Interpro Link:IPR003614
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Oliveira F.,Mu J.,Laughinghouse A.,Teixeira C.R.,Jochim R.C.,
  •   Title:The midgut transcriptome of Lutzomyia longipalpis: comparative analysis of cDNA libraries from sugar-fed, blood-fed, post-digested and Leishmania infantum chagasi-infected sand flies.
  •   Journal:BMC Genomics, 2008, 9, 15-15  [PubMed:18194529]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: