Record in detail


General Info

  • lamp_id:L06AT00005
  • Name:DEF1_VIGUN
  • FullName:Defensin-like protein 1
  • Source:Vigna unguiculata
  • Mass:5172.9 Da
  • Sequence Length:47 aa
  • Isoelectric Point:8.61
  • Activity:Antimicrobial
  • Sequence
        RVCESQSHGFKGACTGDHNCALVCRNEGFSGGNCRGFRRRCFCTLKC
  • Function:Inhibits trypsin but not chymotrypsin.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L06AT00005    From 1 To 47 E-value: 7e-22 Score: 94.4
        RVCESQSHGFKGACTGDHNCALVCRNEGFSGGNCRGFRRRCFCTLKC
  • 2. L12A06371|    From 32 To 78 E-value: 0.000000000000002 Score: 73.2
        RTCESQSHRFKGPCSRDSNCATVCLTEGFSGGDCRGFRRRCFCTRPC
  • 3. L03A000162    From 31 To 77 E-value: 0.000000000000008 Score: 70.9
        RTCESQSHRFKGTCVSASNCANVCHNEGFVGGNCRGFRRRCFCTRHC
  • 4. L11A010684    From 1 To 47 E-value: 0.00000000000001 Score: 70.5
        RTCESQSHRFKGPCARDSNCATVCLTEGFSGGDCRGFRRRCFCTRPC
  • 5. L03A000169    From 32 To 78 E-value: 0.00000000000002 Score: 69.7
        RTCESQSHKFKGTCLSDTNCANVCHSERFSGGKCRGFRRRCFCTTHC

Structure

  •   Domains
  •   1  Name:G_Purothionin    Interpro Link:IPR008177
  •   2  Name:Gamma-thionin    Interpro Link:IPR008176
  •   3  Name:Knot1    Interpro Link:IPR003614
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Ary M.B.,Mello L.V.,Franco O.L.,Rigden D.J.,Melo F.R.,
  •   Title:Inhibition of trypsin by cowpea thionin: characterization, molecular modeling, and docking.
  •   Journal:Proteins, 2002, 48, 311-319  [MEDLINE:22107283]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: