Record in detail


General Info

  • lamp_id:L06AT00032
  • Name:Q9FS38_EUTWA
  • FullName:
  • Source:Eutrema wasabi
  • Mass:5719.5 Da
  • Sequence Length:51 aa
  • Isoelectric Point:8.21
  • Activity:Antimicrobial
  • Sequence
        QKLCEKSSGTWSGVCGNNNACKNQCINLEGARHGSCNYIFPYHRCICYFPC
  • Function:null

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000090    From 30 To 80 E-value: 4e-27 Score: 111
        QKLCEKSSGTWSGVCGNNNACKNQCINLEGARHGSCNYIFPYHRCICYFPC
  • 2. L06AT00032    From 1 To 51 E-value: 8e-26 Score: 107
        QKLCEKSSGTWSGVCGNNNACKNQCINLEGARHGSCNYIFPYHRCICYFPC
  • 3. L01A002031    From 1 To 51 E-value: 1e-25 Score: 106
        QKLCERSSGTWSGVCGNNNACKNQCINLEGARHGSCNYIFPYHRCICYFPC
  • 4. L11A001965    From 2 To 51 E-value: 7e-25 Score: 104
        KLCERSSGTWSGVCGNNNACKNQCINLEGARHGSCNYIFPYHRCICYFPC
  • 5. L02A001687    From 1 To 50 E-value: 9e-25 Score: 103
        KLCERSSGTWSGVCGNNNACKNQCINLEGARHGSCNYVFPYHRCICYFPC

Structure

  •   Domains
  •   1  Name:Gamma-thionin    Interpro Link:IPR008176
  •   2  Name:Knot1    Interpro Link:IPR003614
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Suzuki K.,Yamamura S.,Nishihara M.,Kiba A.,Saitoh H.,
  •   Title:Production of antimicrobial defensin in Nicotiana benthamiana with a potato virus X vector.
  •   Journal:Mol. Plant Microbe Interact., 2001, 14, 111-115  [MEDLINE:21071227]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: