Record in detail


General Info

  • lamp_id:L06AT00035
  • Name:DEF05_ARATH
  • FullName:Defensin-like protein 5
  • Source:Arabidopsis thaliana
  • Mass:5175.7 Da
  • Sequence Length:47 aa
  • Isoelectric Point:7.97
  • Activity:Antimicrobial
  • Sequence
        RTCETSSNLFNGPCLSSSNCANVCHNEGFSDGDCRGFRRRCLCTRPC
  • Function:Confers broad-spectrum resistance to pathogens.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05ADEF280    From 30 To 76 E-value: 4e-23 Score: 98.2
        RTCETSSNLFNGPCLSSSNCANVCHNEGFSDGDCRGFRRRCLCTRPC
  • 2. L06AT00035    From 1 To 47 E-value: 6e-22 Score: 94.4
        RTCETSSNLFNGPCLSSSNCANVCHNEGFSDGDCRGFRRRCLCTRPC
  • 3. L05ADEF281    From 31 To 77 E-value: 5e-16 Score: 75.1
        RTCESKSHRFKGPCVSTHNCANVCHNEGFGGGKCRGFRRRCYCTRHC
  • 4. L03A000162    From 31 To 77 E-value: 7e-16 Score: 74.3
        RTCESQSHRFKGTCVSASNCANVCHNEGFVGGNCRGFRRRCFCTRHC
  • 5. L06AT00036    From 1 To 47 E-value: 0.000000000000001 Score: 73.2
        RTCESKSHRFKGPCVSTHNCANVCHNEGFGGGKCRGFRRRCYCTRHC

Structure

  •   Domains
  •   1  Name:G_Purothionin    Interpro Link:IPR008177
  •   2  Name:Gamma-thionin    Interpro Link:IPR008176
  •   3  Name:Knot1    Interpro Link:IPR003614
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Kaul S.,Federspiel N.A.,Palm C.J.,Ecker J.R.,Theologis A.,
  •   Title:Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana.
  •   Journal:Nature, 2000, 408, 816-820  [MEDLINE:21016719]
  •   [2]  Cock J.M.,Dumas C.,Miege C.,Vanoosthuyse V.,
  •   Title:Two large Arabidopsis thaliana gene families are homologous to the Brassica gene superfamily that encodes pollen coat proteins and the male component of the self-incompatibility response.
  •   Journal:Plant Mol. Biol., 2001, 46, 17-34  [MEDLINE:21330246]
  •   [3]  Thevissen K.,Cammue B.P.,Thomma B.P.H.J.,
  •   Title:Plant defensins.
  •   Journal:Planta, 2002, 216, 193-202  [PubMed:12447532]
  •   [4]  VandenBosch K.A.,Paape T.D.,Graham M.A.,Silverstein K.A.T.,
  •   Title:Genome organization of more than 300 defensin-like genes in Arabidopsis.
  •   Journal:Plant Physiol., 2005, 138, 600-610  [PubMed:15955924]
  •   [5]  Hilson P.,Town C.D.,Whitford R.,Vanderhaeghen R.,Underwood B.A.,
  •   Title:Simultaneous high-throughput recombinational cloning of open reading frames in closed and open configurations.
  •   Journal:Plant Biotechnol. J., 2006, 4, 317-324  [PubMed:17147637]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: