Record in detail


General Info

  • lamp_id:L06AT00036
  • Name:DEF01_ARATH
  • FullName:Defensin-like protein 1
  • Source:Arabidopsis thaliana
  • Mass:5348.1 Da
  • Sequence Length:47 aa
  • Isoelectric Point:9.31
  • Activity:Antimicrobial
  • Sequence
        RTCESKSHRFKGPCVSTHNCANVCHNEGFGGGKCRGFRRRCYCTRHC
  • Function:Confers broad-spectrum resistance to pathogens.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05ADEF281    From 31 To 77 E-value: 3e-23 Score: 98.6
        RTCESKSHRFKGPCVSTHNCANVCHNEGFGGGKCRGFRRRCYCTRHC
  • 2. L06AT00036    From 1 To 47 E-value: 6e-22 Score: 94.4
        RTCESKSHRFKGPCVSTHNCANVCHNEGFGGGKCRGFRRRCYCTRHC
  • 3. L03A000162    From 31 To 77 E-value: 3e-19 Score: 85.5
        RTCESQSHRFKGTCVSASNCANVCHNEGFVGGNCRGFRRRCFCTRHC
  • 4. L06AT00037    From 1 To 47 E-value: 5e-18 Score: 81.6
        RTCESQSHRFKGTCVSASNCANVCHNEGFVGGNCRGFRRRCFCTRHC
  • 5. L03A000169    From 32 To 78 E-value: 3e-17 Score: 78.6
        RTCESQSHKFKGTCLSDTNCANVCHSERFSGGKCRGFRRRCFCTTHC

Structure

  •   Domains
  •   1  Name:G_Purothionin    Interpro Link:IPR008177
  •   2  Name:Gamma-thionin    Interpro Link:IPR008176
  •   3  Name:Knot1    Interpro Link:IPR003614
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Bohlmann H.,Apel K.,Epple P.,
  •   Title:ESTs reveal a multigene family for plant defensins in Arabidopsis thaliana.
  •   Journal:FEBS Lett., 1997, 400, 168-172  [PubMed:9001391]
  •   [2]  Benito M.-I.,Shea T.P.,Rounsley S.D.,Kaul S.,Lin X.,
  •   Title:Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana.
  •   Journal:Nature, 1999, 402, 761-768  [MEDLINE:20083487]
  •   [3]  Cock J.M.,Dumas C.,Miege C.,Vanoosthuyse V.,
  •   Title:Two large Arabidopsis thaliana gene families are homologous to the Brassica gene superfamily that encodes pollen coat proteins and the male component of the self-incompatibility response.
  •   Journal:Plant Mol. Biol., 2001, 46, 17-34  [MEDLINE:21330246]
  •   [4]  Thevissen K.,Cammue B.P.,Thomma B.P.H.J.,
  •   Title:Plant defensins.
  •   Journal:Planta, 2002, 216, 193-202  [PubMed:12447532]
  •   [5]  Shinn P.,Chen H.,Dale J.M.,Lim J.,Yamada K.,
  •   Title:Empirical analysis of transcriptional activity in the Arabidopsis genome.
  •   Journal:Science, 2003, 302, 842-846  [MEDLINE:22954850]
  •   [6]  VandenBosch K.A.,Paape T.D.,Graham M.A.,Silverstein K.A.T.,
  •   Title:Genome organization of more than 300 defensin-like genes in Arabidopsis.
  •   Journal:Plant Physiol., 2005, 138, 600-610  [PubMed:15955924]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: