Record in detail


General Info

  • lamp_id:L06AT00041
  • Name:DEF08_ARATH
  • FullName:Defensin-like protein 8
  • Source:Arabidopsis thaliana
  • Mass:6451.3 Da
  • Sequence Length:57 aa
  • Isoelectric Point:7.15
  • Activity:Antimicrobial
  • Sequence
        EVSPLDNKICKTRSDRFSGVCISTNNCAIICQQFEHFDGGHCEFDGAFRRCMCTKQC
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05ADEF269    From 24 To 80 E-value: 2e-30 Score: 122
        EVSPLDNKICKTRSDRFSGVCISTNNCAIICQQFEHFDGGHCEFDGAFRRCMCTKQC
  • 2. L06AT00041    From 1 To 57 E-value: 2e-29 Score: 119
        EVSPLDNKICKTRSDRFSGVCISTNNCAIICQQFEHFDGGHCEFDGAFRRCMCTKQC
  • 3. L05ADEF317    From 27 To 82 E-value: 0.0000000009 Score: 53.9
        QLEPAEGRTCKTPSGKFKGVCASRNNCKNVCQT-EGFPSGSCDFHVANRKCYCSKPC
  • 4. L03A000062    From 1 To 47 E-value: 0.000000003 Score: 52.4
        KICRRRSAGFKGPCMSNKNCAQVCQQ-EGWGGGNC--DGPFRRCKCIRQC
  • 5. L13A025438    From 1 To 49 E-value: 0.000000003 Score: 52.4
        RYCLSQSHRFKGLCMSSSNCANVCQT-ENFPGGECKADGATRKCFCKKIC

Structure

  •   Domains
  •   1  Name:Gamma-thionin    Interpro Link:IPR008176
  •   2  Name:Knot1    Interpro Link:IPR003614
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Benito M.-I.,Shea T.P.,Rounsley S.D.,Kaul S.,Lin X.,
  •   Title:Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana.
  •   Journal:Nature, 1999, 402, 761-768  [MEDLINE:20083487]
  •   [2]  Cock J.M.,Dumas C.,Miege C.,Vanoosthuyse V.,
  •   Title:Two large Arabidopsis thaliana gene families are homologous to the Brassica gene superfamily that encodes pollen coat proteins and the male component of the self-incompatibility response.
  •   Journal:Plant Mol. Biol., 2001, 46, 17-34  [MEDLINE:21330246]
  •   [3]  VandenBosch K.A.,Paape T.D.,Graham M.A.,Silverstein K.A.T.,
  •   Title:Genome organization of more than 300 defensin-like genes in Arabidopsis.
  •   Journal:Plant Physiol., 2005, 138, 600-610  [PubMed:15955924]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: