Record in detail


General Info

  • lamp_id:L06AT00043
  • Name:DEF07_ARATH
  • FullName:Defensin-like protein 7
  • Source:Arabidopsis thaliana
  • Mass:6135.3 Da
  • Sequence Length:53 aa
  • Isoelectric Point:8.8
  • Activity:Antimicrobial
  • Sequence
        QQMCEAKSLDWKGMCLKWRNCRQVCISEGFTDGRCKGFTRKCICSKPCFVLPN
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05ADEF286    From 30 To 82 E-value: 8e-28 Score: 114
        QQMCEAKSLDWKGMCLKWRNCRQVCISEGFTDGRCKGFTRKCICSKPCFVLPN
  • 2. L06AT00043    From 1 To 53 E-value: 7e-27 Score: 110
        QQMCEAKSLDWKGMCLKWRNCRQVCISEGFTDGRCKGFTRKCICSKPCFVLPN
  • 3. L05ADEF277    From 32 To 82 E-value: 2e-16 Score: 76.6
        QLCETKSLNYRGLCLKWRSCKRVCISEGFPDGRCKGFFNNKCVCRKPCALL
  • 4. L06AT00044    From 3 To 53 E-value: 4e-16 Score: 75.1
        QLCETKSLNYRGLCLKWRSCKRVCISEGFPDGRCKGFFNNKCVCRKPCALL
  • 5. L03A000089    From 27 To 74 E-value: 0.00000000006 Score: 58.2
        AKICEALSGNFKGLCLSSRDCGNVCRREGFTDGSCIGFRLQCFCTKPC

Structure

  •   Domains
  •   1  Name:G_Purothionin    Interpro Link:IPR008177
  •   2  Name:Gamma-thionin    Interpro Link:IPR008176
  •   3  Name:Knot1    Interpro Link:IPR003614
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Benito M.-I.,Shea T.P.,Rounsley S.D.,Kaul S.,Lin X.,
  •   Title:Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana.
  •   Journal:Nature, 1999, 402, 761-768  [MEDLINE:20083487]
  •   [2]  Cock J.M.,Dumas C.,Miege C.,Vanoosthuyse V.,
  •   Title:Two large Arabidopsis thaliana gene families are homologous to the Brassica gene superfamily that encodes pollen coat proteins and the male component of the self-incompatibility response.
  •   Journal:Plant Mol. Biol., 2001, 46, 17-34  [MEDLINE:21330246]
  •   [3]  VandenBosch K.A.,Paape T.D.,Graham M.A.,Silverstein K.A.T.,
  •   Title:Genome organization of more than 300 defensin-like genes in Arabidopsis.
  •   Journal:Plant Physiol., 2005, 138, 600-610  [PubMed:15955924]
  •   [4]  Graham M.A.,Underwood B.A.,Wu H.C.,Moskal W.A. Jr.,Silverstein K.A.T.,
  •   Title:Small cysteine-rich peptides resembling antimicrobial peptides have been under-predicted in plants.
  •   Journal:Plant J., 2007, 51, 262-280  [PubMed:17565583]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: