Record in detail


General Info

  • lamp_id:L06AT00056
  • Name:THNB_WHEAT
  • FullName:Purothionin A-1
  • Source:Triticum aestivum
  • Mass:4926.8 Da
  • Sequence Length:45 aa
  • Isoelectric Point:9.63
  • Activity:Antimicrobial
  • Sequence
        KSCCKSTLGRNCYNLCRARGAQKLCANVCRCKLTSGLSCPKDFPK
  • Function:Thionins are small plant proteins which are toxic to animal cells. They seem to exert their toxic effect at the level of the cell membrane. Their precise function is not known.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L06AT00056    From 1 To 45 E-value: 1e-20 Score: 89.7
        KSCCKSTLGRNCYNLCRARGAQKLCANVCRCKLTSGLSCPKDFPK
  • 2. L12A05311|    From 1 To 45 E-value: 2e-18 Score: 82.8
        KSCCKNTLGRNCYNLCRARGAPKLCSTVCRCKLTSGLSCPKDFPK
  • 3. L13A025115    From 1 To 45 E-value: 3e-18 Score: 82.4
        KSCCRSTLGRNCYNLCRARGAQKLCAGVCRCKISSGLSCPKGFPK
  • 4. L06AT00057    From 1 To 45 E-value: 6e-18 Score: 81.3
        KSCCRTTLGRNCYNLCRSRGAQKLCSTVCRCKLTSGLSCPKGFPK
  • 5. L06AT00059    From 1 To 45 E-value: 1e-17 Score: 80.1
        KSCCRSTLGRNCYNLCRVRGAQKLCANACRCKLTSGLKCPSSFPK

Structure

  •   Domains
  •   1  Name:Thionin    Interpro Link:IPR001010
  •   Structures

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Yoshizumi H.,Kagamiyama H.,Okada T.,Ohtani S.,
  •   Title:The amino acid sequence of purothionin A, a lethal toxic protein to brewer"s yeast from wheat.
  •   Journal:Agric. Biol. Chem., 1975, 39, 2269-2270  [:]
  •   [2]  Jones B.L.,Mak A.S.,
  •   Title:The amino acid sequence of wheat beta-purothionin.
  •   Journal:Can. J. Biochem., 1976, 54, 835-842  [MEDLINE:77046666]
  •   [3]  Kagamiyama H.,Yoshizumi H.,Okada T.,Ohtani S.,
  •   Title:Complete primary structures of two subunits of purothionin A, a lethal protein for brewer"s yeast from wheat flour.
  •   Journal:J. Biochem., 1977, 82, 753-767  [MEDLINE:78026451]
  •   [4]  Teeter M.M.,Rao U.,Stec B.,
  •   Title:Refinement of purothionins reveals solute particles important for lattice formation and toxicity. Part 2: structure of beta-purothionin at 1.7-A resolution.
  •   Journal:Acta Crystallogr. D, 1995, 51, 914-924  [PubMed:15299761]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: