Record in detail


General Info

  • lamp_id:L06AT00057
  • Name:THN2_WHEAT
  • FullName:Alpha-2-purothionin
  • Source:Triticum aestivum
  • Mass:4929.8 Da
  • Sequence Length:45 aa
  • Isoelectric Point:10.05
  • Activity:Antimicrobial
  • Sequence
        KSCCRTTLGRNCYNLCRSRGAQKLCSTVCRCKLTSGLSCPKGFPK
  • Function:Thionins are small plant proteins which are toxic to animal cells. They seem to exert their toxic effect at the level of the cell membrane. Their precise function is not known.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L06AT00057    From 1 To 45 E-value: 4e-20 Score: 88.6
        KSCCRTTLGRNCYNLCRSRGAQKLCSTVCRCKLTSGLSCPKGFPK
  • 2. L13A025115    From 1 To 45 E-value: 4e-18 Score: 82
        KSCCRSTLGRNCYNLCRARGAQKLCAGVCRCKISSGLSCPKGFPK
  • 3. L06AT00056    From 1 To 45 E-value: 6e-18 Score: 81.3
        KSCCKSTLGRNCYNLCRARGAQKLCANVCRCKLTSGLSCPKDFPK
  • 4. L12A05311|    From 1 To 45 E-value: 1e-17 Score: 80.5
        KSCCKNTLGRNCYNLCRARGAPKLCSTVCRCKLTSGLSCPKDFPK
  • 5. L12A05341|    From 1 To 45 E-value: 2e-17 Score: 79.7
        KSCCRNTLGRNCYNLCRSRGAPKLCATVCRCKISSGLSCPKDFPK

Structure

  •   Domains
  •   1  Name:Thionin    Interpro Link:IPR001010
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Garcia-Olmedo F.,Carbonero P.,Marana C.,Castagnaro A.,
  •   Title:cDNA cloning and nucleotide sequences of alpha 1 and alpha 2 thionins from hexaploid wheat endosperm.
  •   Journal:Plant Physiol., 1994, 106, 1221-1222  [MEDLINE:95125120]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: