Record in detail


General Info

  • lamp_id:L06AT00058
  • Name:THNA_HORVU
  • FullName:Alpha-hordothionin
  • Source:Hordeum vulgare
  • Mass:4483.3 Da
  • Sequence Length:42 aa
  • Isoelectric Point:9.68
  • Activity:Antimicrobial
  • Sequence
        KSCCRSTLGRNCYNLCRVRGAQKLCAGVCRCKLTSSGKCPTG
  • Function:Thionins are small plant proteins which are toxic to animal cells. They seem to exert their toxic effect at the level of the cell membrane. Their precise function is not known.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A05349|    From 1 To 42 E-value: 3e-18 Score: 82
        KSCCRSTLGRNCYNLCRVRGAQKLCAGVCRCKLTSSGKCPTG
  • 2. L06AT00058    From 1 To 42 E-value: 3e-18 Score: 82
        KSCCRSTLGRNCYNLCRVRGAQKLCAGVCRCKLTSSGKCPTG
  • 3. L06AT00059    From 1 To 41 E-value: 0.000000000000008 Score: 70.9
        KSCCRSTLGRNCYNLCRVRGAQKLCANACRCKLTSGLKCPS
  • 4. L13A025115    From 1 To 42 E-value: 0.00000000000001 Score: 70.1
        KSCCRSTLGRNCYNLCRARGAQKLCAGVCRCKISSGLSCPKG
  • 5. L06AT00056    From 1 To 40 E-value: 0.00000000000008 Score: 67.4
        KSCCKSTLGRNCYNLCRARGAQKLCANVCRCKLTSGLSCP

Structure

  •   Domains
  •   1  Name:Thionin    Interpro Link:IPR001010
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Nakanishi T.,Matsubara H.,Hase T.,Wada K.,Ozaki Y.,
  •   Title:Amino acid sequence of a purothionin homolog from barley flour.
  •   Journal:J. Biochem., 1980, 87, 549-555  [MEDLINE:80137408]
  •   [2]  Carbonero P.,Garcia-Olmedo F.,Hernandez-Lucas C.,Paz-Ares J.,Ponz F.,
  •   Title:Cloning and nucleotide sequence of a cDNA encoding the precursor of the barley toxin alpha-hordothionin.
  •   Journal:Eur. J. Biochem., 1986, 156, 131-135  [MEDLINE:86164332]
  •   [3]  Garcia-Olmedo F.,Carbonero P.,Pintor-Toro J.A.,Rodriguez-Palenzuela P.,
  •   Title:Nucleotide sequence and endosperm-specific expression of the structural gene for the toxin alpha-hordothionin in barley (Hordeum vulgare L.).
  •   Journal:Gene, 1988, 70, 271-281  [MEDLINE:89108011]
  •   [4]  Flengsrud R.,Kristoffersen H.E.,
  •   Title:Separation and characterization of basic barley seed proteins.
  •   Journal:Electrophoresis, 2000, 21, 3693-3700  [MEDLINE:21088911]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: