Record in detail


General Info

  • lamp_id:L06AT00060
  • Name:THN_BRARP
  • FullName:Thionin
  • Source:Brassica rapa subsp. pekinensis
  • Mass:4906.6 Da
  • Sequence Length:46 aa
  • Isoelectric Point:8.62
  • Activity:Antimicrobial
  • Sequence
        KICCPRTIDRNIYNACRLTGASMTNCANLSGCKIVSGTTCPPGYTH
  • Function:Thionins are small plant proteins which are toxic to animal cells. They seem to exert their toxic effect at the level of the cell membrane. Their precise function is not known.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L06AT00060    From 1 To 46 E-value: 3e-22 Score: 95.1
        KICCPRTIDRNIYNACRLTGASMTNCANLSGCKIVSGTTCPPGYTH
  • 2. L01A003071    From 1 To 46 E-value: 0.0000000000002 Score: 66.6
        KSCCPSTTARNIYNTCRLTGASRSVCASLSGCKIISGSTCDSGWNH
  • 3. L02A001277    From 1 To 44 E-value: 0.000000000001 Score: 63.5
        KSCCPNTTGRNIYNACRLTGAPRPTCAKLSGCKIISGSTCPSDY
  • 4. L06AT00070    From 1 To 46 E-value: 0.000000000001 Score: 63.5
        KSCCPSTTARNIYNTCRLTGTSRPTCASLSGCKIISGSTCBSGWBH
  • 5. L06AT00093    From 1 To 44 E-value: 0.000000000002 Score: 62.8
        KSCCPNTTGRNIYNACRLTGAPCPTCAKLSGCKIISGSTCPSDY

Structure

  •   Domains
  •   1  Name:Thionin    Interpro Link:IPR001010
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: