Record in detail


General Info

  • lamp_id:L06AT00064
  • Name:THN3_HORVU
  • FullName:Leaf-specific thionin DB4
  • Source:Hordeum vulgare
  • Mass:4911.7 Da
  • Sequence Length:46 aa
  • Isoelectric Point:8.78
  • Activity:Antimicrobial
  • Sequence
        KSCCKDTLARNCYNTCHFAGGSRPVCAGACRCKIISGPKCPSDYPK
  • Function:Thionins are small plant proteins which are toxic to animal cells. They seem to exert their toxic effect at the level of the cell membrane. Their precise function is not known.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L06AT00064    From 1 To 46 E-value: 7e-22 Score: 94.4
        KSCCKDTLARNCYNTCHFAGGSRPVCAGACRCKIISGPKCPSDYPK
  • 2. L01A003070    From 1 To 46 E-value: 4e-21 Score: 91.7
        KSCCKDTLARNCYNTCRFAGGSRPVCAGACRCKIISGPKCPSDYPK
  • 3. L06AT00065    From 1 To 46 E-value: 3e-17 Score: 78.6
        KSCCKNTTGRNCYNACHFAGGSRPVCATACGCKIISGPTCPRDYPK
  • 4. L06AT00078    From 1 To 46 E-value: 2e-16 Score: 75.9
        KSCCKNTTGRNCYNACRFAGGSRPVCATACGCKIISGPTCPRDYPK
  • 5. L06AT00067    From 1 To 46 E-value: 0.000000000000005 Score: 71.2
        KSCCKDTTARNCYNVCRIPGTPRPVCATTCRCKIISGNKCPKDYPK

Structure

  •   Domains
  •   1  Name:Thionin    Interpro Link:IPR001010
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Apel K.,Bohlmann H.,
  •   Title:Isolation and characterization of cDNAs coding for leaf-specific thionins closely related to the endosperm-specific hordothionin of barley (Hordeum vulgare L.).
  •   Journal:Mol. Gen. Genet., 1987, 207, 446-454  [:]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: