Record in detail


General Info

  • lamp_id:L06AT00070
  • Name:THNA_PHOLI
  • FullName:Ligatoxin-A
  • Source:Phoradendron liga
  • Mass:4839.4 Da
  • Sequence Length:46 aa
  • Isoelectric Point:8.89
  • Activity:Antimicrobial
  • Sequence
        KSCCPSTTARNIYNTCRLTGTSRPTCASLSGCKIISGSTCBSGWBH
  • Function:Thionins are small plant proteins which are toxic to animal cells. They seem to exert their toxic effect at the level of the cell membrane. Their precise function is not known.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L06AT00070    From 1 To 46 E-value: 5e-21 Score: 91.3
        KSCCPSTTARNIYNTCRLTGTSRPTCASLSGCKIISGSTCBSGWBH
  • 2. L01A003071    From 1 To 46 E-value: 2e-19 Score: 85.9
        KSCCPSTTARNIYNTCRLTGASRSVCASLSGCKIISGSTCDSGWNH
  • 3. L02A000237    From 1 To 46 E-value: 2e-17 Score: 79.7
        KSCCPTTTARNIYNTCRFGGGSRPVCAKLSGCKIISGTKCDSGWNH
  • 4. L02A001277    From 1 To 44 E-value: 0.000000000000004 Score: 71.6
        KSCCPNTTGRNIYNACRLTGAPRPTCAKLSGCKIISGSTCPSDY
  • 5. L13A019293    From 1 To 44 E-value: 0.000000000000006 Score: 71.2
        KSCCPSTTGRNIYNTCRLTGSSRETCAKLSGCKIISASTCPSNY

Structure

  •   Domains
  •   1  Name:Thionin    Interpro Link:IPR001010
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Samuelsson G.,Thunberg E.,
  •   Title:Isolation and properties of ligatoxin A, a toxic protein from the mistletoe Phoradendron liga.
  •   Journal:Acta Pharm. Suec., 1982, 19, 285-292  [MEDLINE:83044670]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: