Record in detail


General Info

  • lamp_id:L06AT00077
  • Name:Q8LSZ9_AVESA
  • FullName:
  • Source:Avena sativa
  • Mass:4763.4 Da
  • Sequence Length:45 aa
  • Isoelectric Point:8.59
  • Activity:Antimicrobial
  • Sequence
        KSCCPSTSARNCYNVCRLTGTSRPRCASLCGCKIVDGTCPDGYSK
  • Function:null

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L06AT00077    From 1 To 45 E-value: 1e-20 Score: 90.1
        KSCCPSTSARNCYNVCRLTGTSRPRCASLCGCKIVDGTCPDGYSK
  • 2. L06AT00070    From 1 To 46 E-value: 0.0000000000006 Score: 64.3
        KSCCPSTTARNIYNTCRLTGTSRPTCASLSGCKIISGSTCBSGWBH
  • 3. L06AT00062    From 1 To 44 E-value: 0.000000000002 Score: 62.8
        KSCCPTTAARNQYNICRLPGTPRPVCAALSGCKIISGTGCPPGY
  • 4. L06AT00091    From 1 To 46 E-value: 0.00000000001 Score: 60.5
        KSCCRNTTARNCYNVCRIPGTPRPVCAATCDCKIITGTKCPPGYEK
  • 5. L01A003071    From 1 To 46 E-value: 0.00000000001 Score: 60.5
        KSCCPSTTARNIYNTCRLTGASRSVCASLSGCKIISGSTCDSGWNH

Structure

  •   Domains
  •   1  Name:Thionin    Interpro Link:IPR001010
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Ochiai H.,Nakamura S.,Honkura R.,Kaku H.,Iwai T.,
  •   Title:Enhanced resistance to seed-transmitted bacterial diseases in transgenic rice plants overproducing an oat cell-wall-bound thionin.
  •   Journal:Mol. Plant Microbe Interact., 2002, 15, 515-521  [MEDLINE:22054133]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: