Record in detail


General Info

  • lamp_id:L06AT00078
  • Name:THN7_HORVU
  • FullName:Thionin BTH7
  • Source:Hordeum vulgare
  • Mass:4860.6 Da
  • Sequence Length:46 aa
  • Isoelectric Point:9
  • Activity:Antimicrobial
  • Sequence
        KSCCKNTTGRNCYNACRFAGGSRPVCATACGCKIISGPTCPRDYPK
  • Function:Thionins are small plant proteins which are toxic to animal cells. They seem to exert their toxic effect at the level of the cell membrane. Their precise function is not known.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L06AT00078    From 1 To 46 E-value: 2e-21 Score: 92.4
        KSCCKNTTGRNCYNACRFAGGSRPVCATACGCKIISGPTCPRDYPK
  • 2. L06AT00065    From 1 To 46 E-value: 6e-21 Score: 91.3
        KSCCKNTTGRNCYNACHFAGGSRPVCATACGCKIISGPTCPRDYPK
  • 3. L01A003070    From 1 To 46 E-value: 9e-17 Score: 77.4
        KSCCKDTLARNCYNTCRFAGGSRPVCAGACRCKIISGPKCPSDYPK
  • 4. L06AT00064    From 1 To 46 E-value: 2e-16 Score: 75.9
        KSCCKDTLARNCYNTCHFAGGSRPVCAGACRCKIISGPKCPSDYPK
  • 5. L02A001284    From 1 To 46 E-value: 0.000000000000002 Score: 72.4
        KSCCKNTTGRNIYNTCRFAGGSRERCAKLSGCKIISASTCPSDYPK

Structure

  •   Domains
  •   1  Name:Thionin    Interpro Link:IPR001010
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: