Record in detail


General Info

  • lamp_id:L06AT00086
  • Name:THN21_ARATH
  • FullName:Thionin-2.1
  • Source:Arabidopsis thaliana
  • Mass:4811.5 Da
  • Sequence Length:43 aa
  • Isoelectric Point:9.21
  • Activity:Antimicrobial
  • Sequence
        KICCPSNQARNGYSVCRIRFSKGRCMQVSGCQNSDTCPRGWVN
  • Function:Seems to function as a defense factor. Thionins are small plant proteins which are toxic to animal cells. They seem to exert their toxic effect at the level of the cell membrane. Their precise function is not known.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L06AT00086    From 1 To 43 E-value: 1e-20 Score: 89.7
        KICCPSNQARNGYSVCRIRFSKGRCMQVSGCQNSDTCPRGWVN
  • 2. L06AT00077    From 1 To 43 E-value: 0.00004 Score: 38.5
        KSCCPSTSARNCYNVCRLTGTSRPRCASLCGCKIVDGTCPDGY
  • 3. L01A003071    From 1 To 44 E-value: 0.0002 Score: 36.2
        KSCCPSTTARNIYNTCRLTGASRSVCASLSGCKIISGSTCDSGW
  • 4. L06AT00070    From 1 To 44 E-value: 0.0004 Score: 35.4
        KSCCPSTTARNIYNTCRLTGTSRPTCASLSGCKIISGSTCBSGW
  • 5. L06AT00089    From 2 To 46 E-value: 0.0006 Score: 34.7
        ICCPSIQARTFYNACLFAVGSPSSCIRNSSCLDISESTCPRGYTN

Structure

  •   Domains
  •   1  Name:Thionin    Interpro Link:IPR001010
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Bohlmann H.,Apel K.,Epple P.,
  •   Title:An Arabidopsis thaliana thionin gene is inducible via a signal transduction pathway different from that for pathogenesis-related proteins.
  •   Journal:Plant Physiol., 1995, 109, 813-820  [MEDLINE:96079536]
  •   [2]  Bohlmann H.,Apel K.,Epple P.,
  •   Title:Overexpression of an endogenous thionin enhances resistance of Arabidopsis against Fusarium oxysporum.
  •   Journal:Plant Cell, 1997, 9, 509-520  [PubMed:9144959]
  •   [3]  Bohlmann H.,Apel K.,Wasternack C.,Vignutelli A.,
  •   Title:Systemic and local induction of an Arabidopsis thionin gene by wounding and pathogens.
  •   Journal:Plant J., 1998, 14, 285-295  [PubMed:9628023]
  •   [4]  Kaul S.,Federspiel N.A.,Palm C.J.,Ecker J.R.,Theologis A.,
  •   Title:Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana.
  •   Journal:Nature, 2000, 408, 816-820  [MEDLINE:21016719]
  •   [5]  Shinn P.,Chen H.,Dale J.M.,Lim J.,Yamada K.,
  •   Title:Empirical analysis of transcriptional activity in the Arabidopsis genome.
  •   Journal:Science, 2003, 302, 842-846  [MEDLINE:22954850]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: