Record in detail


General Info

  • lamp_id:L06AT00087
  • Name:THN22_ARATH
  • FullName:Thionin-2.2
  • Source:Arabidopsis thaliana
  • Mass:5202.1 Da
  • Sequence Length:46 aa
  • Isoelectric Point:8.61
  • Activity:Antimicrobial
  • Sequence
        KICCPTKDDRSVYFVCMLSVSSQFYCLLKSKCKNTSQTICPPGYTN
  • Function:Thionins are small plant proteins which are toxic to animal cells. They seem to exert their toxic effect at the level of the cell membrane. Their precise function is not known.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L06AT00087    From 1 To 46 E-value: 5e-22 Score: 94.7
        KICCPTKDDRSVYFVCMLSVSSQFYCLLKSKCKNTSQTICPPGYTN
  • 2. L06AT00060    From 1 To 46 E-value: 0.0000001 Score: 47
        KICCPRTIDRNIYNACRLTGASMTNCANLSGCKIVSGTTCPPGYTH
  • 3. L06AT00089    From 1 To 46 E-value: 0.000002 Score: 43.1
        NICCPSIQARTFYNACLFAVGSPSSCIRNSSCLDISESTCPRGYTN
  • 4. L06AT00062    From 1 To 46 E-value: 0.00002 Score: 39.3
        KSCCPTTAARNQYNICRLPGTPRPVCAALSGCKIISGTGCPPGYRH
  • 5. L13A019293    From 1 To 44 E-value: 0.0003 Score: 35.4
        KSCCPSTTGRNIYNTCRLTGSSRETCAKLSGCKIISASTCPSNY

Structure

  •   Domains
  •   1  Name:Thionin    Interpro Link:IPR001010
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Bohlmann H.,Apel K.,Epple P.,
  •   Title:An Arabidopsis thaliana thionin gene is inducible via a signal transduction pathway different from that for pathogenesis-related proteins.
  •   Journal:Plant Physiol., 1995, 109, 813-820  [MEDLINE:96079536]
  •   [2]  Kotani H.,Nakamura Y.,Kaneko T.,Sato S.,Asamizu E.,
  •   Title:Structural analysis of Arabidopsis thaliana chromosome 5. VIII. Sequence features of the regions of 1,081,958 bp covered by seventeen physically assigned P1 and TAC clones.
  •   Journal:DNA Res., 1998, 5, 379-391  [MEDLINE:99156233]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: