Record in detail


General Info

  • lamp_id:L06AT00089
  • Name:THN24_ARATH
  • FullName:Probable thionin-2.4
  • Source:Arabidopsis thaliana
  • Mass:4951.5 Da
  • Sequence Length:46 aa
  • Isoelectric Point:7.73
  • Activity:Antimicrobial
  • Sequence
        NICCPSIQARTFYNACLFAVGSPSSCIRNSSCLDISESTCPRGYTN
  • Function:Thionins are small plant proteins which are toxic to animal cells. They seem to exert their toxic effect at the level of the cell membrane. Their precise function is not known.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L06AT00089    From 1 To 46 E-value: 1e-21 Score: 93.6
        NICCPSIQARTFYNACLFAVGSPSSCIRNSSCLDISESTCPRGYTN
  • 2. L06AT00087    From 1 To 46 E-value: 0.000002 Score: 43.1
        KICCPTKDDRSVYFVCMLSVSSQFYCLLKSKCKNTSQTICPPGYTN
  • 3. L02A001280    From 3 To 44 E-value: 0.000004 Score: 42
        CCPNTTGRNIYNTCRFAGGSRERCAKLSGCKIISASTCPSDY
  • 4. L02A001278    From 3 To 44 E-value: 0.000006 Score: 41.2
        CCPNTTGRNIYNTCRFGGGSREVCARISGCKIISASTCPSDY
  • 5. L06AT00060    From 1 To 46 E-value: 0.00002 Score: 39.7
        KICCPRTIDRNIYNACRLTGASMTNCANLSGCKIVSGTTCPPGYTH

Structure

  •   Domains
  •   1  Name:Thionin    Interpro Link:IPR001010
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Kaul S.,Federspiel N.A.,Palm C.J.,Ecker J.R.,Theologis A.,
  •   Title:Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana.
  •   Journal:Nature, 2000, 408, 816-820  [MEDLINE:21016719]
  •   [2]  Shinn P.,Chen H.,Dale J.M.,Lim J.,Yamada K.,
  •   Title:Empirical analysis of transcriptional activity in the Arabidopsis genome.
  •   Journal:Science, 2003, 302, 842-846  [MEDLINE:22954850]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: