Record in detail


General Info

  • lamp_id:L06AT00094
  • Name:THN1_VISAL
  • FullName:Viscotoxin-1-PS
  • Source:Viscum album
  • Mass:4901.6 Da
  • Sequence Length:46 aa
  • Isoelectric Point:9.54
  • Activity:Antimicrobial
  • Sequence
        KSCCPBTTGRBIYBTCRFGGGSRZVCARISGCKIISASTCPSYPBK
  • Function:Thionins are small plant proteins which are toxic to animal cells. They seem to exert their toxic effect at the level of the cell membrane. Their precise function is not known.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L06AT00094    From 1 To 46 E-value: 5e-21 Score: 91.7
        KSCCPBTTGRBIYBTCRFGGGSRZVCARISGCKIISASTCPSYPBK
  • 2. L06AT00095    From 1 To 46 E-value: 4e-20 Score: 88.6
        KSCCPNTTGRNIYNTCRFGGGSREVCASLSGCKIISASTCPSYPDK
  • 3. L02A001278    From 1 To 45 E-value: 2e-18 Score: 82.8
        KSCCPNTTGRNIYNTCRFGGGSREVCARISGCKIISASTCPSDYP
  • 4. L02A001281    From 1 To 45 E-value: 2e-17 Score: 79.7
        KSCCPNTTGRNIYNTCRFGGGSRQVCASLSGCKIISASTCPSDYP
  • 5. L02A001280    From 1 To 45 E-value: 1e-16 Score: 76.6
        KSCCPNTTGRNIYNTCRFAGGSRERCAKLSGCKIISASTCPSDYP

Structure

  •   Domains
  •   1  Name:Thionin    Interpro Link:IPR001010
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Jayawardene A.L.,Samuelsson G.,
  •   Title:Isolation and characterization of viscotoxin 1-Ps from Viscum album L. ssp. austriacum (Wiesb.) vollmann, growing on Pinus silvestris.
  •   Journal:Acta Pharm. Suec., 1974, 11, 175-184  [MEDLINE:75019816]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: