Record in detail


General Info

  • lamp_id:L06AT00095
  • Name:THN2_VISAL
  • FullName:Viscotoxin-A2
  • Source:Viscum album
  • Mass:4834.4 Da
  • Sequence Length:46 aa
  • Isoelectric Point:8.62
  • Activity:Antimicrobial
  • Sequence
        KSCCPNTTGRNIYNTCRFGGGSREVCASLSGCKIISASTCPSYPDK
  • Function:Thionins are small plant proteins which are toxic to animal cells. They seem to exert their toxic effect at the level of the cell membrane. Their precise function is not known.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L06AT00095    From 1 To 46 E-value: 1e-21 Score: 93.6
        KSCCPNTTGRNIYNTCRFGGGSREVCASLSGCKIISASTCPSYPDK
  • 2. L06AT00094    From 1 To 46 E-value: 4e-20 Score: 88.6
        KSCCPBTTGRBIYBTCRFGGGSRZVCARISGCKIISASTCPSYPBK
  • 3. L02A001281    From 1 To 45 E-value: 1e-18 Score: 84
        KSCCPNTTGRNIYNTCRFGGGSRQVCASLSGCKIISASTCPSDYP
  • 4. L02A001278    From 1 To 45 E-value: 3e-18 Score: 82
        KSCCPNTTGRNIYNTCRFGGGSREVCARISGCKIISASTCPSDYP
  • 5. L02A001282    From 1 To 45 E-value: 1e-17 Score: 80.5
        KSCCPNTTGRNIYNTCRLGGGSRERCASLSGCKIISASTCPSDYP

Structure

  •   Domains
  •   1  Name:Thionin    Interpro Link:IPR001010
  •   Structures

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Samuelsson G.,Olson T.,
  •   Title:The amino acid sequence of viscotoxin A2 from the European mistletoe (Viscum album L., Loranthaceae).
  •   Journal:Acta Chem. Scand., 1972, 26, 585-595  [MEDLINE:72211843]
  •   [2]  Samuelsson G.,Olson T.,
  •   Title:The disulphide bonds of viscotoxin A2 from the European mistletoe (Viscum album L. Loranthaceae).
  •   Journal:Acta Pharm. Suec., 1974, 11, 381-386  [MEDLINE:75015879]
  •   [3]  Schaller G.,Sautereau A.-M.,Lopez A.,Mosbah A.,Coulon A.,
  •   Title:Comparative membrane interaction study of viscotoxins A3, A2 and B from mistletoe (Viscum album) and connections with their structures.
  •   Journal:Biochem. J., 2003, 374, 71-78  [PubMed:12733989]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: