Record in detail


General Info

  • lamp_id:L06AT00102
  • Name:NLTP6_GOSHI
  • FullName:Non-specific lipid-transfer protein 6
  • Source:Gossypium hirsutum
  • Mass:10118.7 Da
  • Sequence Length:94 aa
  • Isoelectric Point:9.98
  • Activity:Antimicrobial
  • Sequence
        AISYDQVKSSLLPCVGYVRGNNARPAPPNYCKGIRSLKSAARIRLDRQAACKCIKSLAADISDINYGVAAGLPGQCNVHIPYKISPSIDCKRVK
  • Function:Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L06AT00102    From 1 To 94 E-value: 0 Score: 187
        AISYDQVKSSLLPCVGYVRGNNARPAPPNYCKGIRSLKSAARIRLDRQAACKCIKSLAADISDINYGVAAGLPGQCNVHIPYKISPSIDCKRVK
  • 2. L06AT00135    From 1 To 90 E-value: 8e-22 Score: 94
        AISCGQVSSALSPCISYARGSGSSP-PAACCSGVRSLAGAARSTADKQAACKCIKSAAG---GLNAGKAAGIPSKCGVSIPYAISSSVDCSKIR
  • 3. L06AT00140    From 1 To 93 E-value: 9e-22 Score: 94
        AISCGQVASAIAPCISYARGQGSAPSA-GCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN
  • 4. L06AT00139    From 1 To 93 E-value: 1e-21 Score: 93.6
        AISCGQVASAIAPCISYARGQGSGPSA-GCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN
  • 5. L06AT00141    From 1 To 93 E-value: 2e-21 Score: 92.4
        AISCGQVASAIAPCISYARGQGSGPSA-GCCSGVKSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN

Structure

  •   Domains
  •   1  Name:Bifunc_inhib/LTP/seed_store    Interpro Link:IPR016140
  •   2  Name:Lipid_transfer_prot_hlx-dom    Interpro Link:IPR013770
  •   3  Name:Plant_LTP    Interpro Link:IPR000528
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Jenkins J.N.,Greech R.G.,Tan H.,Liu H.-C.,Ma D.-P.,
  •   Title:Cloning and characterization of a cotton lipid transfer protein gene specifically expressed in fiber cells.
  •   Journal:Biochim. Biophys. Acta, 1997, 1344, 111-114  [MEDLINE:97182142]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: