Record in detail


General Info

  • lamp_id:L06AT00105
  • Name:NLTP2_HORVU
  • FullName:Probable non-specific lipid-transfer protein
  • Source:Hordeum vulgare
  • Mass:6987.9 Da
  • Sequence Length:67 aa
  • Isoelectric Point:7.24
  • Activity:Antimicrobial
  • Sequence
        ACEPAQLAVCASAILGGTKPSGECCGNLRAQQGCLCQYVKDPNYGHYVSSPHARDTLNLCGIPVPHC
  • Function:Potential phospholipid transfer protein.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L06AT00105    From 1 To 67 E-value: 5e-35 Score: 137
        ACEPAQLAVCASAILGGTKPSGECCGNLRAQQGCLCQYVKDPNYGHYVSSPHARDTLNLCGIPVPHC
  • 2. L01A003075    From 8 To 79 E-value: 0.29 Score: 25.8
        SKLAPCIGYLQGAPGPSAACCGGIKSLNSAAASPADRKTACTCLKSAATSIKGINYGKAASLPRQ------CGVSVPY
  • 3. L06AT00104    From 8 To 32 E-value: 0.29 Score: 25.8
        SKMKPCLTYVQGGPGPSGECCNGVR
  • 4. L06AT00111    From 8 To 79 E-value: 0.64 Score: 24.6
        SKLAPCIGYLQGAPGPSAACCGGIKSLNSAAASPADRKTACTCLKSAATSMKGINYGKAASLPRQ------CGVSIPY
  • 5. L06AT00136    From 22 To 38 E-value: 3.1 Score: 22.3
        GTSPSGACCSGVRKLAG

Structure

  •   Domains
  •   1  Name:Bifunc_inhib/LTP/seed_store    Interpro Link:IPR016140
  •   2  Name:Lipid_transfer_prot_hlx-dom    Interpro Link:IPR013770
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Alexander D.,Bosnes M.,Aalen R.B.,Klemsdal S.S.,Jakobsen K.,
  •   Title:Barley aleurone cell development: molecular cloning of aleurone-specific cDNAs from immature grains.
  •   Journal:Plant Mol. Biol., 1989, 12, 285-293  [:]
  •   [2]  Linnestad C.,Nielsen P.,Potter R.,Shimamoto K.,Kalla R.,
  •   Title:The promoter of the barley aleurone-specific gene encoding a putative 7 kDa lipid transfer protein confers aleurone cell-specific expression in transgenic rice.
  •   Journal:Plant J., 1994, 6, 849-860  [MEDLINE:95152558]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: