Record in detail


General Info

  • lamp_id:L06AT00107
  • Name:NLT42_HORVU
  • FullName:Non-specific lipid-transfer protein 4.2
  • Source:Hordeum vulgare
  • Mass:8691 Da
  • Sequence Length:90 aa
  • Isoelectric Point:9.24
  • Activity:Antimicrobial
  • Sequence
        AISCGQVSSALSPCISYARGNGAKPPVACCSGVKRLAGAAQSTADKQAACKCIKSAAGGLNAGKAAGIPSMCGVSVPYAISASVDCSKIR
  • Function:Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L06AT00107    From 1 To 90 E-value: 8.40779e-45 Score: 170
        AISCGQVSSALSPCISYARGNGAKPPVACCSGVKRLAGAAQSTADKQAACKCIKSAAGGLNAGKAAGIPSMCGVSVPYAISASVDCSKIR
  • 2. L01A003074    From 1 To 90 E-value: 2.94273e-44 Score: 168
        AISCGQVSSALSPCISYARGNGAKPPAACCSGVKRLAGAAQSTADKQAACKCIKSAAGGLNAGKAAGIPSMCGVSVPYAISASVDCSKIR
  • 3. L06AT00135    From 1 To 90 E-value: 1e-39 Score: 153
        AISCGQVSSALSPCISYARGSGSSPPAACCSGVRSLAGAARSTADKQAACKCIKSAAGGLNAGKAAGIPSKCGVSIPYAISSSVDCSKIR
  • 4. L06AT00137    From 1 To 90 E-value: 2e-35 Score: 139
        AISCGQVNSALASCVSYAKGSGASPPGACCSGVRRLAGLARSTADKQAACRCIKSAAGGLNPGKAASIPSKCGVSIPYSISASVDCSKIH
  • 5. L06AT00130    From 1 To 90 E-value: 3e-35 Score: 139
        AITCGQVSSALSPCIPYARGNGANPSAACCSGVRRIAGAVQSTADKKTACNCIKRAAGGLNAGKAADIPSKCSVSIPYAINPSVDCSTIR

Structure

  •   Domains
  •   1  Name:Bifunc_inhib/LTP/seed_store    Interpro Link:IPR016140
  •   2  Name:Lipid_transfer_prot_hlx-dom    Interpro Link:IPR013770
  •   3  Name:Plant_LTP    Interpro Link:IPR000528
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Hughes M.A.,Brown K.,Dunn M.A.,White A.J.,
  •   Title:Comparative analysis of genomic sequence and expression of a lipid transfer protein gene family in winter barley.
  •   Journal:J. Exp. Bot., 1994, 45, 1885-1892  [:]
  •   [2]  Garcia-Olmedo F.,Carbonero P.,Vasil I.K.,Diaz I.,Molina A.,
  •   Title:Two cold-inducible genes encoding lipid transfer protein LTP4 from barley show differential responses to bacterial pathogens.
  •   Journal:Mol. Gen. Genet., 1996, 252, 162-168  [MEDLINE:96397495]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: