Record in detail


General Info

  • lamp_id:L06AT00113
  • Name:NLTP1_LENCU
  • FullName:Non-specific lipid-transfer protein 1
  • Source:Lens culinaris
  • Mass:9358.8 Da
  • Sequence Length:93 aa
  • Isoelectric Point:9.9
  • Activity:Antimicrobial
  • Sequence
        AISCGTVSGALVPCLTYLKGGPGPSPQCCGGVKRLNGAARTTIDRRAACNCLKSSAGSISGLKPGNVATLPGKCGVRLPYTISTSTNCNTIRF
  • Function:Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L06AT00113    From 1 To 93 E-value: 0 Score: 181
        AISCGTVSGALVPCLTYLKGGPGPSPQCCGGVKRLNGAARTTIDRRAACNCLKSSAGSISGLKPGNVATLPGKCGVRLPYTISTSTNCNTIRF
  • 2. L06AT00116    From 1 To 93 E-value: 4e-35 Score: 137
        AISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTSTNCNTVKF
  • 3. L01A003077    From 1 To 93 E-value: 5e-35 Score: 137
        AISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVDIPYKISTSTNCNTVKF
  • 4. L06AT00114    From 1 To 93 E-value: 9e-35 Score: 137
        AISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVKF
  • 5. L01A003076    From 1 To 92 E-value: 4e-34 Score: 134
        AISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTSTNCNTVK

Structure

  •   Domains
  •   1  Name:Bifunc_inhib/LTP/seed_store    Interpro Link:IPR016140
  •   2  Name:Lipid_transfer_prot_hlx-dom    Interpro Link:IPR013770
  •   3  Name:Plant_LTP    Interpro Link:IPR000528
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Tagaev A.A.,Potapenko N.A.,Serebryakova M.V.,Balandin S.V.,Finkina E.I.,
  •   Title:Purification and primary structure of novel lipid transfer proteins from germinated lentil (Lens culinaris) seeds.
  •   Journal:Biokhimiia, 2007, 72, 430-438  [PubMed:17511608]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: