Record in detail


General Info

  • lamp_id:L06AT00121
  • Name:NLTP1_TOBAC
  • FullName:Non-specific lipid-transfer protein 1
  • Source:Nicotiana tabacum
  • Mass:9172.5 Da
  • Sequence Length:91 aa
  • Isoelectric Point:8.78
  • Activity:Antimicrobial
  • Sequence
        AITCGQVTSNLAPCLAYLRNTGPLGRCCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYKISPSTDCSKVQ
  • Function:Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. Binds cis-unsaturated fatty acids and jasmonic acid with a higher affinity than linear chain fatty acids. Formation of the complex with jasmonic acid results in a conformational change facilitating the LPT1 binding on the elicitin plasma membrane receptor that is known to be involved in plant defense induction. May also play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L06AT00121    From 1 To 91 E-value: 0 Score: 180
        AITCGQVTSNLAPCLAYLRNTGPLGRCCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYKISPSTDCSKVQ
  • 2. L06AT00112    From 1 To 91 E-value: 5e-30 Score: 121
        AIGCNTVASKMAPCLPYVTGKGPLGGCCGGVKGLIDAARTTPDRQAVCNCLKTLAKSYSGINLGNAAGLPGKCGVSIPYQISPNTDCSKVH
  • 3. L06AT00141    From 1 To 93 E-value: 4e-27 Score: 111
        AISCGQVASAIAPCISYARGQGSGPSAGCCSGVKSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN
  • 4. L06AT00139    From 1 To 93 E-value: 8e-27 Score: 110
        AISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN
  • 5. L06AT00140    From 1 To 93 E-value: 1e-26 Score: 110
        AISCGQVASAIAPCISYARGQGSAPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN

Structure

  •   Domains
  •   1  Name:Bifunc_inhib/LTP/seed_store    Interpro Link:IPR016140
  •   2  Name:Lipid_transfer_prot_hlx-dom    Interpro Link:IPR013770
  •   3  Name:Plant_LTP    Interpro Link:IPR000528
  •   Structures

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  de Vries S.C.,Sterk P.,Hofmann S.,Mandel T.,Fleming A.J.,
  •   Title:Expression pattern of a tobacco lipid transfer protein gene within the shoot apex.
  •   Journal:Plant J., 1992, 2, 855-862  [MEDLINE:93258425]
  •   [2]  Dupuis I.,Fleming A.J.,Mandel T.,Caderas D.,Canevascini S.,
  •   Title:Tissue-specific expression and promoter analysis of the tobacco Ltp1 gene.
  •   Journal:Plant Physiol., 1996, 112, 513-524  [MEDLINE:97037728]
  •   [3]  Marion D.,Ponchet M.,Milat M.L.,Gomes E.,Buhot N.,
  •   Title:Modulation of the biological activity of a tobacco LTP1 by lipid complexation.
  •   Journal:Mol. Biol. Cell, 2004, 15, 5047-5052  [PubMed:15356262]
  •   [4]  Marion D.,Marais A.,Industri B.,Landon C.,Da Silva P.,
  •   Title:Solution structure of a tobacco lipid transfer protein exhibiting new biophysical and biological features.
  •   Journal:Proteins, 2005, 59, 356-367  [PubMed:15726627]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: