Record in detail


General Info

  • lamp_id:L06AT00122
  • Name:Q2RBD2_ORYSJ
  • FullName:HASH(0x1ac286c)
  • Source:Oryza sativa subsp. japonica
  • Mass:8966.1 Da
  • Sequence Length:92 aa
  • Isoelectric Point:9.26
  • Activity:Antimicrobial
  • Sequence
        AITCGQVNSAVGPCLTYARGGAGPSAACCSGVRSLKAAASSTADRRTACNCLKNAARGIKGLNAGNAASIPSKCGVSVPYTISASIDCSRVS
  • Function:Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L06AT00122    From 1 To 92 E-value: 0 Score: 175
        AITCGQVNSAVGPCLTYARGGAGPSAACCSGVRSLKAAASSTADRRTACNCLKNAARGIKGLNAGNAASIPSKCGVSVPYTISASIDCSRVS
  • 2. L06AT00123    From 1 To 91 E-value: 1.00053e-42 Score: 162
        ITCGQVNSAVGPCLTYARGGGAGPSAACCNGVRSLKSAARTTADRRTACNCLKNAARGIKGLNAGNAASIPSKCGVSVPYTISASIDCSRV
  • 3. L06AT00142    From 1 To 92 E-value: 5e-38 Score: 147
        AITCGQVSSAIAPCLSYARGTGSGPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRV
  • 4. L06AT00134    From 1 To 93 E-value: 7e-38 Score: 147
        AVTCGQVSSAIGPCLSYARGQGSGPSAGCCSGVRSLNSAARTTADRRAACNCLKNAARGIRGLNVGKAASIPSKCGVSIPYTISTSTDCSRVS
  • 5. L06AT00133    From 1 To 93 E-value: 4e-36 Score: 141
        AISCGQVSSAIALCLSYARGQGFAPSAGCCSGVRSLNSAARTTADRRAACNCLKNAARGISGLNAGNAASIPSKCGVSVPYTISTSTDCSRVS

Structure

  •   Domains
  •   1  Name:Bifunc_inhib/LTP/seed_store    Interpro Link:IPR016140
  •   2  Name:Lipid_transfer_prot_hlx-dom    Interpro Link:IPR013770
  •   3  Name:Plant_LTP    Interpro Link:IPR000528
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  
  •   Title:The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
  •   Journal:BMC Biol., 2005, 3, 20-20  [PubMed:16188032]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: