Record in detail


General Info

  • lamp_id:L06AT00125
  • Name:NLTP1_VIGRR
  • FullName:Non-specific lipid-transfer protein 1
  • Source:Vigna radiata var. radiata
  • Mass:9298.7 Da
  • Sequence Length:91 aa
  • Isoelectric Point:9.01
  • Activity:Antimicrobial
  • Sequence
        MTCGQVQGNLAQCIGFLQKGGVVPPSCCTGVKNILNSSRTTADRRAVCSCLKAAAGAVRGINPNNAEALPGKCGVNIPYKISTSTNCNSIN
  • Function:Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues. Has antifungal activity against F.solani, F.oxysporum, P.aphanidermatum and S.rolfsii. Has antibacterial activity against the Gram-positive bacterium S.aureus but not against the Gram-negative bacterium S.typhimurium.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L06AT00125    From 1 To 91 E-value: 0 Score: 181
        MTCGQVQGNLAQCIGFLQKGGVVPPSCCTGVKNILNSSRTTADRRAVCSCLKAAAGAVRGINPNNAEALPGKCGVNIPYKISTSTNCNSIN
  • 2. L12A09441|    From 1 To 80 E-value: 3.99931e-42 Score: 161
        MTCGQVQGNLAQCIGFLQKGGVVPPSCCTGVKNILNSSRTTADRRAVCSCLKAAAGAVRGINPNNAEALPGKCGVNIPYK
  • 3. L06AT00101    From 2 To 91 E-value: 4e-28 Score: 115
        ITCGQVTHNVAPCFNYVKSGGAVPAACCKGVSNLNSMAKTTADRQQTCNCLKSAAGSIKGLNANLAAGLPGKCGVNVPYKISTSTNCNNV
  • 4. L06AT00115    From 2 To 91 E-value: 4e-26 Score: 108
        VSCGTVTGDLAPCIPYLTGGAGPTDSCCAGVKKLLAAAPTTADRQAACNCLKTAAGNINNLNPGNAAALPGKCNVNIPYKISTTTNCNTI
  • 5. L06AT00116    From 2 To 91 E-value: 2e-25 Score: 106
        ISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTSTNCNTV

Structure

  •   Domains
  •   1  Name:Bifunc_inhib/LTP/seed_store    Interpro Link:IPR016140
  •   2  Name:Lipid_transfer_prot_hlx-dom    Interpro Link:IPR013770
  •   3  Name:Plant_LTP    Interpro Link:IPR000528
  •   Structures

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Rao P.F.,Ye X.Y.,Ng T.B.,Wu J.H.,Wang S.Y.,
  •   Title:A non-specific lipid transfer protein with antifungal and antibacterial activities from the mung bean.
  •   Journal:Peptides, 2004, 25, 1235-1242  [PubMed:15350690]
  •   [2]  Cheng C.-S.,Samuel D.,Hsu S.-T.,Liu Y.-N.,Lin K.-F.,
  •   Title:Characterization and structural analyses of nonspecific lipid transfer protein 1 from mung bean.
  •   Journal:Biochemistry, 2005, 44, 5703-5712  [PubMed:15823028]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: