Record in detail


General Info

  • lamp_id:L06AT00128
  • Name:NLTPC_RICCO
  • FullName:Non-specific lipid-transfer protein C, cotyledon-specific isoform
  • Source:Ricinus communis
  • Mass:9593.1 Da
  • Sequence Length:92 aa
  • Isoelectric Point:8.79
  • Activity:Antimicrobial
  • Sequence
        AVPCSTVDMKAAACVGFATGKDSKPSQACCTGLQQLAQTVKTVDDKKAICRCLKASSKSLGIKDQFLSKIPAACNIKVGFPVSTNTNCETIH
  • Function:Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L06AT00128    From 1 To 92 E-value: 0 Score: 184
        AVPCSTVDMKAAACVGFATGKDSKPSQACCTGLQQLAQTVKTVDDKKAICRCLKASSKSLGIKDQFLSKIPAACNIKVGFPVSTNTNCETIH
  • 2. L06AT00129    From 1 To 92 E-value: 0 Score: 178
        AVPCSTVDMKAAACVGFATGKDSKPSSACCTGLQQLAQTVKSVDDKKAICRCLKASSKSLGIKDQFLSKIPAACNIKVGFPVSTATNCETIH
  • 3. L02A001245    From 1 To 90 E-value: 0.000000000000003 Score: 72.4
        AVTCNTVVSSLAPCVPFFAGSAAQPTAACCNGVRSLNSAARTTPDRRTACNCIKSSASSIGLNYNKAAKLPSRCTVNVTVPISPSVNCAT
  • 4. L06AT00138    From 1 To 90 E-value: 0.000000000000006 Score: 71.2
        AIPCGQVNSALASCVSYAKGSGASPPGACCSGVRRLAGLARSTADKQAACRCIK--SAAGGLNPGKAASIPSKCGVSIPYSISASVDCSKIH
  • 5. L06AT00131    From 1 To 90 E-value: 0.00000000000001 Score: 70.1
        AISCGQVNSALGPCISYARGSGANTSAACCSGVKRLAGSVRTSDDKKAACLCIKRAAG--GLNPGKAADIPTKCRVTIPYKISSNVNCNNLH

Structure

  •   Domains
  •   1  Name:Bifunc_inhib/LTP/seed_store    Interpro Link:IPR016140
  •   2  Name:Lipid_transfer_prot_hlx-dom    Interpro Link:IPR013770
  •   3  Name:Plant_LTP    Interpro Link:IPR000528
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Mamiya G.,Suga T.,Yamada M.,Watanabe S.,Takishima K.,
  •   Title:Amino acid sequences of two nonspecific lipid-transfer proteins from germinated castor bean.
  •   Journal:Eur. J. Biochem., 1988, 177, 241-249  [MEDLINE:89052691]
  •   [2]  Matsui K.,Mamiya G.,Takishima K.,Suga T.,Tsuboi S.,
  •   Title:Organ-specific occurrence and expression of the isoforms of nonspecific lipid transfer protein in castor bean seedlings, and molecular cloning of a full-length cDNA for a cotyledon-specific isoform.
  •   Journal:J. Biochem., 1991, 110, 823-831  [MEDLINE:92147605]
  •   [3]  Komor E.,Weig A.,
  •   Title:The lipid-transfer protein C of Ricinus communis L.: isolation of two cDNA sequences which are strongly and exclusively expressed in cotyledons after germination.
  •   Journal:Planta, 1992, 187, 367-371  [:]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: