Record in detail


General Info

  • lamp_id:L06AT00131
  • Name:Q155V0_SECCE
  • FullName:HASH(0x4f742f0)
  • Source:Secale cereale
  • Mass:9098.3 Da
  • Sequence Length:90 aa
  • Isoelectric Point:9.53
  • Activity:Antimicrobial
  • Sequence
        AISCGQVNSALGPCISYARGSGANTSAACCSGVKRLAGSVRTSDDKKAACLCIKRAAGGLNPGKAADIPTKCRVTIPYKISSNVNCNNLH
  • Function:Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L06AT00131    From 1 To 90 E-value: 0 Score: 177
        AISCGQVNSALGPCISYARGSGANTSAACCSGVKRLAGSVRTSDDKKAACLCIKRAAGGLNPGKAADIPTKCRVTIPYKISSNVNCNNLH
  • 2. L06AT00137    From 1 To 90 E-value: 1e-31 Score: 127
        AISCGQVNSALASCVSYAKGSGASPPGACCSGVRRLAGLARSTADKQAACRCIKSAAGGLNPGKAASIPSKCGVSIPYSISASVDCSKIH
  • 3. L06AT00130    From 1 To 90 E-value: 1e-31 Score: 126
        AITCGQVSSALSPCIPYARGNGANPSAACCSGVRRIAGAVQSTADKKTACNCIKRAAGGLNAGKAADIPSKCSVSIPYAINPSVDCSTIR
  • 4. L06AT00138    From 1 To 90 E-value: 4e-31 Score: 125
        AIPCGQVNSALASCVSYAKGSGASPPGACCSGVRRLAGLARSTADKQAACRCIKSAAGGLNPGKAASIPSKCGVSIPYSISASVDCSKIH
  • 5. L06AT00135    From 1 To 90 E-value: 1e-30 Score: 123
        AISCGQVSSALSPCISYARGSGSSPPAACCSGVRSLAGAARSTADKQAACKCIKSAAGGLNAGKAAGIPSKCGVSIPYAISSSVDCSKIR

Structure

  •   Domains
  •   1  Name:Bifunc_inhib/LTP/seed_store    Interpro Link:IPR016140
  •   2  Name:Lipid_transfer_prot_hlx-dom    Interpro Link:IPR013770
  •   3  Name:Plant_LTP    Interpro Link:IPR000528
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  McConkey B.J.,Griffith M.,Yaish M.W.,Doxey A.C.,
  •   Title:Ordered surface carbons distinguish antifreeze proteins and their ice-binding regions.
  •   Journal:Nat. Biotechnol., 2006, 24, 852-855  [PubMed:16823370]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: