Record in detail


General Info

  • lamp_id:L06AT00132
  • Name:NLTP_SPIOL
  • FullName:Non-specific lipid-transfer protein
  • Source:Spinacia oleracea
  • Mass:8865.3 Da
  • Sequence Length:91 aa
  • Isoelectric Point:8.97
  • Activity:Antimicrobial
  • Sequence
        GITCGMVSSKLAPCIGYLKGGPLGGGCCGGIKALNAAAATTPDRKTACNCLKSAANAIKGINYGKAAGLPGMCGVHIPYAISPSTNCNAVH
  • Function:Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L06AT00132    From 1 To 91 E-value: 0 Score: 176
        GITCGMVSSKLAPCIGYLKGGPLGGGCCGGIKALNAAAATTPDRKTACNCLKSAANAIKGINYGKAAGLPGMCGVHIPYAISPSTNCNAVH
  • 2. L01A003075    From 1 To 91 E-value: 1e-33 Score: 133
        ITCGLVASKLAPCIGYLQGAPGPSAACCGGIKSLNSAAASPADRKTACTCLKSAATSIKGINYGKAASLPRQCGVSVPYAISPNTNCNAIH
  • 3. L06AT00111    From 1 To 91 E-value: 2e-33 Score: 132
        ITCGLVASKLAPCIGYLQGAPGPSAACCGGIKSLNSAAASPADRKTACTCLKSAATSMKGINYGKAASLPRQCGVSIPYAISPNTNCNAIH
  • 4. L06AT00121    From 2 To 91 E-value: 4e-28 Score: 115
        ITCGQVTSNLAPCLAYLRNTGPLGR-CCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYKISPSTDCSKVQ
  • 5. L06AT00112    From 2 To 91 E-value: 5e-26 Score: 108
        IGCNTVASKMAPCLPYVTGKGPLGG-CCGGVKGLIDAARTTPDRQAVCNCLKTLAKSYSGINLGNAAGLPGKCGVSIPYQISPNTDCSKVH

Structure

  •   Domains
  •   1  Name:Bifunc_inhib/LTP/seed_store    Interpro Link:IPR016140
  •   2  Name:Lipid_transfer_prot_hlx-dom    Interpro Link:IPR013770
  •   3  Name:Plant_LTP    Interpro Link:IPR000528
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Kader J.-C.,Duranton H.,Vergnolle C.,Drischel C.,Bouillon P.,
  •   Title:The primary structure of spinach-leaf phospholipid-transfer protein.
  •   Journal:Eur. J. Biochem., 1987, 166, 387-391  [MEDLINE:87275922]
  •   [2]  Somerville C.R.,Botella J.,Thoma S.,Bernhard W.R.,
  •   Title:Isolation of a cDNA clone for spinach lipid transfer protein and evidence that the protein is synthesized by the secretory pathway.
  •   Journal:Plant Physiol., 1991, 95, 164-170  [PubMed:16667945]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: