Record in detail


General Info

  • lamp_id:L06AT00138
  • Name:Q1KMV1_WHEAT
  • FullName:HASH(0x4eed5d8)
  • Source:Triticum aestivum
  • Mass:8739.9 Da
  • Sequence Length:90 aa
  • Isoelectric Point:9.24
  • Activity:Antimicrobial
  • Sequence
        AIPCGQVNSALASCVSYAKGSGASPPGACCSGVRRLAGLARSTADKQAACRCIKSAAGGLNPGKAASIPSKCGVSIPYSISASVDCSKIH
  • Function:Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L06AT00138    From 1 To 90 E-value: 4.2039e-45 Score: 171
        AIPCGQVNSALASCVSYAKGSGASPPGACCSGVRRLAGLARSTADKQAACRCIKSAAGGLNPGKAASIPSKCGVSIPYSISASVDCSKIH
  • 2. L06AT00137    From 1 To 90 E-value: 2.94273e-44 Score: 168
        AISCGQVNSALASCVSYAKGSGASPPGACCSGVRRLAGLARSTADKQAACRCIKSAAGGLNPGKAASIPSKCGVSIPYSISASVDCSKIH
  • 3. L06AT00136    From 1 To 90 E-value: 4e-38 Score: 148
        AISCGQVSSALTPCVAYAKGSGTSPSGACCSGVRKLAGLARSTADKQATCRCLKSVAGGLNPNKAAGIPSKCGVSVPYTISASVDCSKIH
  • 4. L06AT00135    From 1 To 90 E-value: 4e-36 Score: 141
        AISCGQVSSALSPCISYARGSGSSPPAACCSGVRSLAGAARSTADKQAACKCIKSAAGGLNAGKAAGIPSKCGVSIPYAISSSVDCSKIR
  • 5. L01A003074    From 1 To 90 E-value: 3e-35 Score: 138
        AISCGQVSSALSPCISYARGNGAKPPAACCSGVKRLAGAAQSTADKQAACKCIKSAAGGLNAGKAAGIPSMCGVSVPYAISASVDCSKIR

Structure

  •   Domains
  •   1  Name:Bifunc_inhib/LTP/seed_store    Interpro Link:IPR016140
  •   2  Name:Lipid_transfer_prot_hlx-dom    Interpro Link:IPR013770
  •   3  Name:Plant_LTP    Interpro Link:IPR000528
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Puchalski B.,Huel R.,Frick M.,Laroche A.,Gaudet D.A.,
  •   Title:Cold induced expression of plant defensin and lipid transfer protein transcripts in winter wheat.
  •   Journal:Physiol. Plantarum, 2003, 117, 195-205  [:]
  •   [2]  Puchalski B.,Frick M.,Lu Z.X.,Gaudet D.A.,Sun J.Y.,
  •   Title:Characterization and antifungal properties of wheat nonspecific lipid transfer proteins.
  •   Journal:Mol. Plant Microbe Interact., 2008, 21, 346-360  [PubMed:18257684]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: