Record in detail


General Info

  • lamp_id:L06AT00141
  • Name:Q2XX25_ZEAMP
  • FullName:HASH(0x4e95710)
  • Source:Zea mays subsp. parviglumis
  • Mass:9026 Da
  • Sequence Length:93 aa
  • Isoelectric Point:8.79
  • Activity:Antimicrobial
  • Sequence
        AISCGQVASAIAPCISYARGQGSGPSAGCCSGVKSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN
  • Function:Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L06AT00141    From 1 To 93 E-value: 0 Score: 177
        AISCGQVASAIAPCISYARGQGSGPSAGCCSGVKSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN
  • 2. L06AT00139    From 1 To 93 E-value: 0 Score: 176
        AISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN
  • 3. L06AT00140    From 1 To 93 E-value: 0 Score: 174
        AISCGQVASAIAPCISYARGQGSAPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN
  • 4. L06AT00133    From 1 To 93 E-value: 6.99949e-42 Score: 160
        AISCGQVSSAIALCLSYARGQGFAPSAGCCSGVRSLNSAARTTADRRAACNCLKNAARGISGLNAGNAASIPSKCGVSVPYTISTSTDCSRVS
  • 5. L06AT00134    From 1 To 93 E-value: 8.00001e-42 Score: 160
        AVTCGQVSSAIGPCLSYARGQGSGPSAGCCSGVRSLNSAARTTADRRAACNCLKNAARGIRGLNVGKAASIPSKCGVSIPYTISTSTDCSRVS

Structure

  •   Domains
  •   1  Name:Bifunc_inhib/LTP/seed_store    Interpro Link:IPR016140
  •   2  Name:Lipid_transfer_prot_hlx-dom    Interpro Link:IPR013770
  •   3  Name:Plant_LTP    Interpro Link:IPR000528
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Tiffin P.,Moeller D.A.,
  •   Title:Genetic diversity and the evolutionary history of plant immunity genes in two species of Zea.
  •   Journal:Mol. Biol. Evol., 2005, 22, 2480-2490  [PubMed:16120802]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: