Record in detail


General Info

  • lamp_id:L06AT00146
  • Name:CIRC_CHAPA
  • FullName:Circulin-C
  • Source:Chassalia parviflora
  • Mass:3125.7 Da
  • Sequence Length:30 aa
  • Isoelectric Point:8.11
  • Activity:Antimicrobial
  • Sequence
        GIPCGESCVFIPCITSVAGCSCKSKVCYRN
  • Function:Probably participates in a plant defense mechanism. Inhibits the cytopathic effects of the human immunodeficiency virus.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L06AT00146    From 1 To 30 E-value: 0.000000000007 Score: 61.2
        GIPCGESCVFIPCITSVAGCSCKSKVCYRN
  • 2. L12A03152|    From 1 To 30 E-value: 0.00000000003 Score: 58.9
        GIPCGESCVFIPCITGIAGCSCKSKVCYRN
  • 3. L12A05610|    From 63 To 91 E-value: 0.00000000003 Score: 58.9
        IPCGESCVFIPCISSVLGCSCKNKVCYRN
  • 4. L01A002717    From 1 To 30 E-value: 0.00000000003 Score: 58.9
        GIPCGESCVFIPCLTTVAGCSCKNKVCYRN
  • 5. L11A004486    From 1 To 30 E-value: 0.0000000001 Score: 57
        GIPCGESCVFIPCLTSAIGCSCKSKVCYRN

Structure

  •   Domains
  •   1  Name:Cyclotide    Interpro Link:IPR005535
  •   2  Name:Cyclotide_bracelet_CS    Interpro Link:IPR012323
  •   3  Name:Cyclotide_subgr    Interpro Link:IPR017307
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Pannell L.K.,Johnson D.G.,Sowder R.C. Jr.,Walton L.K.,Gustafson K.R.,
  •   Title:New circulin macrocyclic polypeptides from Chassalia parvifolia.
  •   Journal:J. Nat. Prod., 2000, 63, 176-178  [PubMed:10691702]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: