Record in detail


General Info

  • lamp_id:L06AT00160
  • Name:CYH4_VIOHE
  • FullName:Cycloviolacin-H4
  • Source:Viola hederacea
  • Mass:3121.6 Da
  • Sequence Length:30 aa
  • Isoelectric Point:3.85
  • Activity:Antimicrobial
  • Sequence
        GIPCAESCVWIPCTVTALLGCSCSNNVCYN
  • Function:Probably participates in a plant defense mechanism. Has potent hemolytic activity.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A06260|    From 45 To 74 E-value: 0.000000000002 Score: 62.8
        GIPCAESCVWIPCTITALMGCSCKNNVCYN
  • 2. L06AT00160    From 1 To 30 E-value: 0.000000000005 Score: 61.6
        GIPCAESCVWIPCTVTALLGCSCSNNVCYN
  • 3. L02A001143    From 1 To 30 E-value: 0.00000000001 Score: 60.1
        GIPCAESCVWIPCTVTALLGCSCSNKVCYN
  • 4. L11A004283    From 1 To 30 E-value: 0.00000000002 Score: 59.3
        GIPCAESCVWIPCTITALMGCSCKNNVCYN
  • 5. L06AT00161    From 1 To 30 E-value: 0.00000000005 Score: 58.2
        GIPCAESCVYIPCTVTALLGCSCSNRVCYN

Structure

  •   Domains
  •   1  Name:Cyclotide    Interpro Link:IPR005535
  •   2  Name:Cyclotide_bracelet_CS    Interpro Link:IPR012323
  •   3  Name:Cyclotide_subgr    Interpro Link:IPR017307
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Craik D.J.,Wang C.,Colgrave M.L.,Chen B.,
  •   Title:Cycloviolacin H4, a hydrophobic cyclotide from Viola hederaceae.
  •   Journal:J. Nat. Prod., 2006, 69, 23-28  [PubMed:16441062]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: