Record in detail
General Info
- lamp_id:L06AT00161
- Name:CYO1_VIOOD
- FullName:Cycloviolacin-O1
- Source:Viola odorata
- Mass:3140.6 Da
- Sequence Length:30 aa
- Isoelectric Point:5.93
- Activity:Antimicrobial
- Sequence
GIPCAESCVYIPCTVTALLGCSCSNRVCYN - Function:Probably participates in a plant defense mechanism.
Cross-Linking
- Cross-linking
- 1 Database:CAMP CAMPSQ6431
- 2 Database:DBAASP 5239
- 3 Database:dbAMP dbAMP_03145
- 4 Database:DRAMP DRAMP00804
- 5 Database:SATPdb satpdb20844
- 6 Database:Uniprot P82230
- 7 Database:PHY PHYT00161
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L06AT00161 From 1 To 30 E-value: 0.000000000006 Score: 61.2
GIPCAESCVYIPCTVTALLGCSCSNRVCYN - 2. L02A001143 From 1 To 30 E-value: 0.00000000002 Score: 59.7
GIPCAESCVWIPCTVTALLGCSCSNKVCYN - 3. L12A06267| From 45 To 74 E-value: 0.00000000002 Score: 59.3
GFPCAESCVYIPCTVTALLGCSCRNRVCYR - 4. L12A06268| From 45 To 74 E-value: 0.00000000003 Score: 58.9
GIPCAESCVYIPCTITALFGCSCKDKVCYN - 5. L06AT00154 From 1 To 30 E-value: 0.00000000003 Score: 58.9
GIPCAESCVYIPCTITALLGCSCKNKVCYN
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Waine C.,Bond T.,Daly N.L.,Craik D.J.,
- Title:Plant cyclotides: a unique family of cyclic and knotted proteins that defines the cyclic cystine knot structural motif.
- Journal:J. Mol. Biol., 1999, 294, 1327-1336 [MEDLINE:20069951]
- [2] Craik D.J.,Waine C.,Plan M.R.R.,Daly N.L.,Rosengren K.J.,
- Title:Twists, knots, and rings in proteins. Structural definition of the cyclotide framework.
- Journal:J. Biol. Chem., 2003, 278, 8606-8616 [PubMed:12482868]
- [3] Craik D.J.,Colgrave M.L.,Ireland D.C.,
- Title:A novel suite of cyclotides from Viola odorata: sequence variation and the implications for structure, function and stability.
- Journal:Biochem. J., 2006, 400, 1-12 [PubMed:16872274]
Comments
- Comments
No comments found on LAMP database