Record in detail


General Info

  • lamp_id:L06AT00161
  • Name:CYO1_VIOOD
  • FullName:Cycloviolacin-O1
  • Source:Viola odorata
  • Mass:3140.6 Da
  • Sequence Length:30 aa
  • Isoelectric Point:5.93
  • Activity:Antimicrobial
  • Sequence
        GIPCAESCVYIPCTVTALLGCSCSNRVCYN
  • Function:Probably participates in a plant defense mechanism.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L06AT00161    From 1 To 30 E-value: 0.000000000006 Score: 61.2
        GIPCAESCVYIPCTVTALLGCSCSNRVCYN
  • 2. L02A001143    From 1 To 30 E-value: 0.00000000002 Score: 59.7
        GIPCAESCVWIPCTVTALLGCSCSNKVCYN
  • 3. L12A06267|    From 45 To 74 E-value: 0.00000000002 Score: 59.3
        GFPCAESCVYIPCTVTALLGCSCRNRVCYR
  • 4. L12A06268|    From 45 To 74 E-value: 0.00000000003 Score: 58.9
        GIPCAESCVYIPCTITALFGCSCKDKVCYN
  • 5. L06AT00154    From 1 To 30 E-value: 0.00000000003 Score: 58.9
        GIPCAESCVYIPCTITALLGCSCKNKVCYN

Structure

  •   Domains
  •   1  Name:Cyclotide    Interpro Link:IPR005535
  •   2  Name:Cyclotide_bracelet_CS    Interpro Link:IPR012323
  •   3  Name:Cyclotide_subgr    Interpro Link:IPR017307
  •   Structures

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Waine C.,Bond T.,Daly N.L.,Craik D.J.,
  •   Title:Plant cyclotides: a unique family of cyclic and knotted proteins that defines the cyclic cystine knot structural motif.
  •   Journal:J. Mol. Biol., 1999, 294, 1327-1336  [MEDLINE:20069951]
  •   [2]  Craik D.J.,Waine C.,Plan M.R.R.,Daly N.L.,Rosengren K.J.,
  •   Title:Twists, knots, and rings in proteins. Structural definition of the cyclotide framework.
  •   Journal:J. Biol. Chem., 2003, 278, 8606-8616  [PubMed:12482868]
  •   [3]  Craik D.J.,Colgrave M.L.,Ireland D.C.,
  •   Title:A novel suite of cyclotides from Viola odorata: sequence variation and the implications for structure, function and stability.
  •   Journal:Biochem. J., 2006, 400, 1-12  [PubMed:16872274]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: