Record in detail
General Info
- lamp_id:L06AT00162
- Name:CYO10_VIOOD
- FullName:Cycloviolacin-O10
- Source:Viola odorata
- Mass:3141.7 Da
- Sequence Length:30 aa
- Isoelectric Point:8.11
- Activity:Antimicrobial
- Sequence
GIPCGESCVYIPCLTSAVGCSCKSKVCYRN - Function:Probably participates in a plant defense mechanism.
Cross-Linking
- Cross-linking
- 1 Database:CAMP CAMPSQ6413
- 2 Database:dbAMP dbAMP_03172
- 3 Database:DRAMP DRAMP00813
- 4 Database:SATPdb satpdb26671
- 5 Database:Uniprot P58442
- 6 Database:PHY PHYT00162
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L06AT00162 From 1 To 30 E-value: 0.000000000006 Score: 61.2
GIPCGESCVYIPCLTSAVGCSCKSKVCYRN - 2. L06AT00157 From 1 To 30 E-value: 0.000000000008 Score: 60.8
GIPCGESCVYIPCLTSAIGCSCKSKVCYRN - 3. L06AT00184 From 1 To 30 E-value: 0.00000000001 Score: 60.5
GIPCGESCVWIPCLTSAVGCSCKSKVCYRN - 4. L11A004486 From 1 To 30 E-value: 0.00000000001 Score: 60.1
GIPCGESCVFIPCLTSAIGCSCKSKVCYRN - 5. L06AT00178 From 1 To 30 E-value: 0.00000000001 Score: 60.1
GIPCGESCVWIPCLTSAIGCSCKSKVCYRN
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Waine C.,Bond T.,Daly N.L.,Craik D.J.,
- Title:Plant cyclotides: a unique family of cyclic and knotted proteins that defines the cyclic cystine knot structural motif.
- Journal:J. Mol. Biol., 1999, 294, 1327-1336 [MEDLINE:20069951]
- [2] Craik D.J.,Colgrave M.L.,Ireland D.C.,
- Title:A novel suite of cyclotides from Viola odorata: sequence variation and the implications for structure, function and stability.
- Journal:Biochem. J., 2006, 400, 1-12 [PubMed:16872274]
Comments
- Comments
No comments found on LAMP database