Record in detail


General Info

  • lamp_id:L06AT00168
  • Name:CYO17_VIOOD
  • FullName:Cycloviolacin-O17
  • Source:Viola odorata
  • Mass:3175.7 Da
  • Sequence Length:30 aa
  • Isoelectric Point:8.11
  • Activity:Antimicrobial
  • Sequence
        GIPCGESCVWIPCISAAIGCSCKNKVCYRN
  • Function:Probably participates in a plant defense mechanism.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L06AT00168    From 1 To 30 E-value: 0.000000000004 Score: 62
        GIPCGESCVWIPCISAAIGCSCKNKVCYRN
  • 2. L01A000224    From 1 To 30 E-value: 0.000000000006 Score: 61.2
        GIPCGESCVWIPCISAALGCSCKNKVCYRN
  • 3. L06AT00179    From 1 To 30 E-value: 0.000000000009 Score: 60.8
        GIPCGESCVWIPCISSAIGCSCKNKVCYRN
  • 4. L02A001064    From 1 To 30 E-value: 0.00000000001 Score: 60.1
        GIPCGESCVWIPCISAAIGCSCKSKVCYRN
  • 5. L12A06234|    From 44 To 73 E-value: 0.00000000002 Score: 59.7
        GVPCGESCVWMYCISAAMGCSCRNKVCYRN

Structure

  •   Domains
  •   1  Name:Cyclotide    Interpro Link:IPR005535
  •   2  Name:Cyclotide_bracelet_CS    Interpro Link:IPR012323
  •   3  Name:Cyclotide_subgr    Interpro Link:IPR017307
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Craik D.J.,Colgrave M.L.,Ireland D.C.,
  •   Title:A novel suite of cyclotides from Viola odorata: sequence variation and the implications for structure, function and stability.
  •   Journal:Biochem. J., 2006, 400, 1-12  [PubMed:16872274]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: