Record in detail


General Info

  • lamp_id:L06AT00169
  • Name:CYO18_VIOOD
  • FullName:Cycloviolacin-O18
  • Source:Viola odorata
  • Mass:3111.7 Da
  • Sequence Length:30 aa
  • Isoelectric Point:8.11
  • Activity:Antimicrobial
  • Sequence
        GIPCGESCVYIPCTVTALAGCKCKSKVCYN
  • Function:Probably participates in a plant defense mechanism.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L06AT00169    From 1 To 30 E-value: 0.000000000006 Score: 61.2
        GIPCGESCVYIPCTVTALAGCKCKSKVCYN
  • 2. L06AT00182    From 1 To 30 E-value: 0.00000000006 Score: 58.2
        SIPCGESCVWIPCTITALAGCKCKSKVCYN
  • 3. L12A06268|    From 45 To 74 E-value: 0.00000000009 Score: 57.4
        GIPCAESCVYIPCTITALFGCSCKDKVCYN
  • 4. L12A06269|    From 45 To 74 E-value: 0.0000000002 Score: 56.6
        GVPCAESCVYIPCTITALFGCSCKDKVCYN
  • 5. L02A001116    From 1 To 30 E-value: 0.0000000004 Score: 55.1
        GIPCAESCVYIPCTITALLGCKCKDQVCYN

Structure

  •   Domains
  •   1  Name:Cyclotide    Interpro Link:IPR005535
  •   2  Name:Cyclotide_bracelet_CS    Interpro Link:IPR012323
  •   3  Name:Cyclotide_subgr    Interpro Link:IPR017307
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Craik D.J.,Colgrave M.L.,Ireland D.C.,
  •   Title:A novel suite of cyclotides from Viola odorata: sequence variation and the implications for structure, function and stability.
  •   Journal:Biochem. J., 2006, 400, 1-12  [PubMed:16872274]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: