Record in detail


General Info

  • lamp_id:L06AT00206
  • Name:VHL1_VIOHE
  • FullName:Leaf cyclotide 1
  • Source:Viola hederacea
  • Mass:3340.9 Da
  • Sequence Length:31 aa
  • Isoelectric Point:6.04
  • Activity:Antimicrobial
  • Sequence
        SISCGESCAMISFCFTEVIGCSCKNKVCYLN
  • Function:Probably participates in a plant defense mechanism. Has anti-human immunodeficiency virus activity.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L06AT00206    From 1 To 31 E-value: 0.000000000003 Score: 62.4
        SISCGESCAMISFCFTEVIGCSCKNKVCYLN
  • 2. L01A002720    From 1 To 28 E-value: 0.00000000005 Score: 58.2
        CGESCAMISFCFTEVIGCSCKNKVCYLN
  • 3. L11A001773    From 1 To 28 E-value: 0.0000000003 Score: 55.8
        CGESCAXISFCFTEVIGCSCKNKVCYLN
  • 4. L02A001082    From 1 To 31 E-value: 0.000002 Score: 42.7
        SISCGESCVYIPCTVTALVGCTCKDKVCYLN
  • 5. L02A001092    From 3 To 30 E-value: 0.000004 Score: 42
        PCGESCVYIP-CFTAVVGCTCKDKVCYLN

Structure

  •   Domains
  •   1  Name:Cyclotide    Interpro Link:IPR005535
  •   2  Name:Cyclotide_bracelet_CS    Interpro Link:IPR012323
  •   Structures

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Gustafson K.R.,Rosengren K.J.,Daly N.L.,Colgrave M.L.,Chen B.,
  •   Title:Isolation and characterization of novel cyclotides from Viola hederaceae: solution structure and anti-HIV activity of vhl-1, a leaf-specific expressed cyclotide.
  •   Journal:J. Biol. Chem., 2005, 280, 22395-22405  [PubMed:15824119]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: