Record in detail


General Info

  • lamp_id:L06AT00207
  • Name:VHL2_VIOHE
  • FullName:Leaf cyclotide 2
  • Source:Viola hederacea
  • Mass:3199.6 Da
  • Sequence Length:30 aa
  • Isoelectric Point:4.19
  • Activity:Antimicrobial
  • Sequence
        GLPVCGETCFTGTCYTNGCTCDPWPVCTRN
  • Function:Probably participates in a plant defense mechanism. Has hemolytic activity.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L06AT00207    From 1 To 30 E-value: 0.000000000002 Score: 62.8
        GLPVCGETCFTGTCYTNGCTCDPWPVCTRN
  • 2. L02A001059    From 1 To 26 E-value: 0.0000000004 Score: 55.1
        CGETCFTGTCYTNGCTCDPWPVCTRN
  • 3. L13A017297    From 1 To 30 E-value: 0.0000000005 Score: 54.7
        GLPVCGETCFGGTCNTPGCTCDPWPVCTRN
  • 4. L13A011084    From 1 To 30 E-value: 0.0000000005 Score: 54.7
        GLPVCGETCFGGTCNTPGCTCDPWPVCTRN
  • 5. L06AT00159    From 1 To 30 E-value: 0.000000001 Score: 53.5
        GLPVCGETCFGGTCNTPGCICDPWPVCTRN

Structure

  •   Domains
  •   1  Name:Cyclotide    Interpro Link:IPR005535
  •   2  Name:Cyclotide_moebius_CS    Interpro Link:IPR012324
  •   3  Name:Cyclotide_subgr    Interpro Link:IPR017307
  •   Structures

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Gustafson K.R.,Rosengren K.J.,Daly N.L.,Colgrave M.L.,Chen B.,
  •   Title:Isolation and characterization of novel cyclotides from Viola hederaceae: solution structure and anti-HIV activity of vhl-1, a leaf-specific expressed cyclotide.
  •   Journal:J. Biol. Chem., 2005, 280, 22395-22405  [PubMed:15824119]
  •   [2]  Craik D.J.,Nguyencong P.,Chen B.,Daly N.L.,
  •   Title:Structure and activity of the leaf-specific cyclotide vhl-2.
  •   Journal:Aust. J. Chem., 2010, 63, 771-778  [DOI:10.1071/CH10007]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: