Record in detail
General Info
- lamp_id:L06AT00217
- Name:VARH_VIOAR
- FullName:Varv peptide H
- Source:Viola arvensis
- Mass:3079.5 Da
- Sequence Length:30 aa
- Isoelectric Point:4.26
- Activity:Antimicrobial
- Sequence
GLPVCGETCFGGTCNTPGCSCETWPVCSRN - Function:Probably participates in a plant defense mechanism.
Cross-Linking
- Cross-linking
- 1 Database:CAMP CAMPSQ2995
- 2 Database:DBAASP 2453
- 3 Database:dbAMP dbAMP_03728
- 4 Database:DRAMP DRAMP00791
- 5 Database:SATPdb satpdb26836
- 6 Database:Uniprot P58453
- 7 Database:PHY PHYT00217
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L06AT00217 From 1 To 30 E-value: 0.000000000004 Score: 62
GLPVCGETCFGGTCNTPGCSCETWPVCSRN - 2. L11A002491 From 1 To 30 E-value: 0.00000000002 Score: 59.7
GLPVCGETCFGGTCNTPGCSCXTWPVCSRN - 3. L06AT00211 From 1 To 30 E-value: 0.00000000006 Score: 57.8
GLPVCGETCFGGTCNTPGCSCDPWPMCSRN - 4. L13A022404 From 1 To 30 E-value: 0.00000000006 Score: 57.8
GLPVCGETCFGGTCNTPGCSCSSWPICTRN - 5. L13A011895 From 1 To 30 E-value: 0.00000000006 Score: 57.8
GLPVCGETCFGGTCNTPGCSCSSWPICTRN
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Claeson P.,Bohlin L.,Johansson S.,Luijendijk T.,Goeransson U.,
- Title:Seven novel macrocyclic polypeptides from Viola arvensis.
- Journal:J. Nat. Prod., 1999, 62, 283-286 [MEDLINE:99177275]
Comments
- Comments
No comments found on LAMP database