Record in detail


General Info

  • lamp_id:L06AT00231
  • Name:HEVE_HEVBR
  • FullName:Pro-hevein
  • Source:Hevea brasiliensis
  • Mass:4727.1 Da
  • Sequence Length:43 aa
  • Isoelectric Point:4.63
  • Activity:Antimicrobial
  • Sequence
        EQCGRQAGGKLCPNNLCCSQWGWCGSTDEYCSPDHNCQSNCKD
  • Function:N-acetyl-D-glucosamine / N-acetyl-D-neuraminic acid binding lectin. Can inhibit fungal growth.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L06AT00231    From 1 To 43 E-value: 3e-20 Score: 89
        EQCGRQAGGKLCPNNLCCSQWGWCGSTDEYCSPDHNCQSNCKD
  • 2. L01A002672    From 1 To 42 E-value: 5e-17 Score: 77.8
        EQCGRQAGGKLCPNNLCCSQYGWCGSSDDYCSPSKNCQSNCK
  • 3. L12A01496|    From 1 To 32 E-value: 0.00000000000009 Score: 67.4
        EQCGRQAGGKLCPNNLCCSQWGWCGSTDEYCS
  • 4. L06AT00228    From 1 To 42 E-value: 0.000000000005 Score: 61.6
        QQCGRQAGNRRCPNNLCCSQFGYCGRTNEYCCTGFGCQSNCR
  • 5. L02A000915    From 1 To 42 E-value: 0.00000000005 Score: 58.2
        QQCGRQAGNRRCANNLCCSQYGYCGRTNEYCCTSQGCQSQCR

Structure

  •   Domains
  •   1  Name:Barwin    Interpro Link:IPR001153
  •   2  Name:Barwin-like_endoglucanase    Interpro Link:IPR014733
  •   3  Name:Barwin-related_endoglucanase    Interpro Link:IPR009009
  •   4  Name:Barwin_CS    Interpro Link:IPR018226
  •   5  Name:Chitin-bd_1    Interpro Link:IPR001002
  •   6  Name:Chitin-binding_1_CS    Interpro Link:IPR018371
  •   Structures

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Raikhel N.,Chua N.H.,Kush A.,Lee H.I.,Broekaert W.F.,
  •   Title:Wound-induced accumulation of mRNA containing a hevein sequence in laticifers of rubber tree (Hevea brasiliensis).
  •   Journal:Proc. Natl. Acad. Sci. U.S.A., 1990, 87, 7633-7637  [MEDLINE:91017559]
  •   [2]  Raikhel N.V.,Broekaert W.F.,Lee H.-I.,
  •   Title:Co- and post-translational processing of the hevein preproprotein of latex of the rubber tree (Hevea brasiliensis).
  •   Journal:J. Biol. Chem., 1991, 266, 15944-15948  [MEDLINE:91340739]
  •   [3]  Soriano-Garcia M.,Ravichandran K.G.,Rodriguez-Romero A.,
  •   Title:Crystal structure of hevein at 2.8-A resolution.
  •   Journal:FEBS Lett., 1991, 291, 307-309  [MEDLINE:92038058]
  •   [4]  Arreguin B.,Rodriguez-Romero A.,Cao B.,Andersen N.H.,
  •   Title:Hevein: NMR assignment and assessment of solution-state folding for the agglutinin-toxin motif.
  •   Journal:Biochemistry, 1993, 32, 1407-1422  [MEDLINE:93160177]
  •   [5]  Chen H.-C.,Kung H.-F.,Huang S.-W.,Chen C.-L.,Chen H.-D.,
  •   Title:Characterization of latex allergenic components by capillary zone electrophoresis and N-terminal sequence analysis.
  •   Journal:J. Biomed. Sci., 1998, 5, 421-427  [MEDLINE:99063804]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: