Record in detail
General Info
- lamp_id:L06AT00231
- Name:HEVE_HEVBR
- FullName:Pro-hevein
- Source:Hevea brasiliensis
- Mass:4727.1 Da
- Sequence Length:43 aa
- Isoelectric Point:4.63
- Activity:Antimicrobial
- Sequence
EQCGRQAGGKLCPNNLCCSQWGWCGSTDEYCSPDHNCQSNCKD - Function:N-acetyl-D-glucosamine / N-acetyl-D-neuraminic acid binding lectin. Can inhibit fungal growth.
Cross-Linking
- Cross-linking
- 1 Database:DBAASP 12396
- 2 Database:dbAMP dbAMP_01495
- 3 Database:DRAMP DRAMP00989
- 4 Database:SATPdb satpdb20837
- 5 Database:Uniprot P02877
- 6 Database:PHY PHYT00231
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L06AT00231 From 1 To 43 E-value: 3e-20 Score: 89
EQCGRQAGGKLCPNNLCCSQWGWCGSTDEYCSPDHNCQSNCKD - 2. L01A002672 From 1 To 42 E-value: 5e-17 Score: 77.8
EQCGRQAGGKLCPNNLCCSQYGWCGSSDDYCSPSKNCQSNCK - 3. L12A01496| From 1 To 32 E-value: 0.00000000000009 Score: 67.4
EQCGRQAGGKLCPNNLCCSQWGWCGSTDEYCS - 4. L06AT00228 From 1 To 42 E-value: 0.000000000005 Score: 61.6
QQCGRQAGNRRCPNNLCCSQFGYCGRTNEYCCTGFGCQSNCR - 5. L02A000915 From 1 To 42 E-value: 0.00000000005 Score: 58.2
QQCGRQAGNRRCANNLCCSQYGYCGRTNEYCCTSQGCQSQCR
Structure
- Domains
- 1 Name:Barwin Interpro Link:IPR001153
- 2 Name:Barwin-like_endoglucanase Interpro Link:IPR014733
- 3 Name:Barwin-related_endoglucanase Interpro Link:IPR009009
- 4 Name:Barwin_CS Interpro Link:IPR018226
- 5 Name:Chitin-bd_1 Interpro Link:IPR001002
- 6 Name:Chitin-binding_1_CS Interpro Link:IPR018371
- Structures
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Raikhel N.,Chua N.H.,Kush A.,Lee H.I.,Broekaert W.F.,
- Title:Wound-induced accumulation of mRNA containing a hevein sequence in laticifers of rubber tree (Hevea brasiliensis).
- Journal:Proc. Natl. Acad. Sci. U.S.A., 1990, 87, 7633-7637 [MEDLINE:91017559]
- [2] Raikhel N.V.,Broekaert W.F.,Lee H.-I.,
- Title:Co- and post-translational processing of the hevein preproprotein of latex of the rubber tree (Hevea brasiliensis).
- Journal:J. Biol. Chem., 1991, 266, 15944-15948 [MEDLINE:91340739]
- [3] Soriano-Garcia M.,Ravichandran K.G.,Rodriguez-Romero A.,
- Title:Crystal structure of hevein at 2.8-A resolution.
- Journal:FEBS Lett., 1991, 291, 307-309 [MEDLINE:92038058]
- [4] Arreguin B.,Rodriguez-Romero A.,Cao B.,Andersen N.H.,
- Title:Hevein: NMR assignment and assessment of solution-state folding for the agglutinin-toxin motif.
- Journal:Biochemistry, 1993, 32, 1407-1422 [MEDLINE:93160177]
- [5] Chen H.-C.,Kung H.-F.,Huang S.-W.,Chen C.-L.,Chen H.-D.,
- Title:Characterization of latex allergenic components by capillary zone electrophoresis and N-terminal sequence analysis.
- Journal:J. Biomed. Sci., 1998, 5, 421-427 [MEDLINE:99063804]
Comments
- Comments
No comments found on LAMP database