Record in detail


General Info

  • lamp_id:L06AT00235
  • Name:Q8H950_EUTWA
  • FullName:
  • Source:Eutrema wasabi
  • Mass:4094.4 Da
  • Sequence Length:40 aa
  • Isoelectric Point:3.75
  • Activity:Antimicrobial
  • Sequence
        QAGGQTCPGGICCSQWGYCGTTADYCSPNNNCQSNCWASG
  • Function:Contains 1 chitin-binding type-1 domain.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L06AT00235    From 1 To 40 E-value: 1e-17 Score: 80.1
        QAGGQTCPGGICCSQWGYCGTTADYCSPNNNCQSNCWASG
  • 2. L06AT00231    From 6 To 41 E-value: 0.0000000001 Score: 57
        QAGGKLCPNNLCCSQWGWCGSTDEYCSPDHNCQSNC
  • 3. L01A002672    From 6 To 45 E-value: 0.0000000008 Score: 53.9
        QAGGKLCPNNLCCSQYGWCGSSDDYCSPSKNCQSNCKGGG
  • 4. L06AT00230    From 6 To 39 E-value: 0.00000006 Score: 48.1
        QGGGQTCPGGLCCSQWGWCGSTPKYC--GAGCQSNC
  • 5. L02A001587    From 6 To 39 E-value: 0.0000002 Score: 46.2
        QGGGATCPGGLCCSQWGWCGSTPKYC--GAGCQSNC

Structure

  •   Domains
  •   1  Name:Barwin    Interpro Link:IPR001153
  •   2  Name:Barwin-like_endoglucanase    Interpro Link:IPR014733
  •   3  Name:Barwin-related_endoglucanase    Interpro Link:IPR009009
  •   4  Name:Barwin_CS    Interpro Link:IPR018226
  •   5  Name:Chitin-bd_1    Interpro Link:IPR001002
  •   6  Name:Chitin-binding_1_CS    Interpro Link:IPR018371
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Yamamura S.,Omiya K.,Nishihara M.,Saitoh H.,Kiba A.,
  •   Title:C-terminal domain of a hevein-like protein from Wasabia japonica has potent antimicrobial activity.
  •   Journal:Plant Cell Physiol., 2003, 44, 296-303  [MEDLINE:22555508]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: