Record in detail


General Info

  • lamp_id:L06AT00238
  • Name:GASA5_ARATH
  • FullName:Gibberellin-regulated protein 5
  • Source:Arabidopsis thaliana
  • Mass:7452.9 Da
  • Sequence Length:66 aa
  • Isoelectric Point:9.61
  • Activity:Antimicrobial
  • Sequence
        GKLKPQQCNSKCSFRCSATSHKKPCMFFCLKCCKKCLCVPPGTFGNKQTCPCYNNWKTKEGRPKCP
  • Function:Gibberellin-regulated protein that acts as a negative regulator of gibberellin-induced flowering and stem growth. May inhibit flowering and inflorescence growth via a pathway involving GAI and by enhancing FLC expression and repressing FT and LFY. Acts as a negative regulator in thermotolerance by resogulating both salicylic acid (SA) signaling and heat shock-protein accumulation.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A000874    From 13 To 78 E-value: 6e-33 Score: 130
        GKLKPQQCNSKCSYRCSATSHKKPCMFFCLKCCKKCLCVPPGTFGNKQTCPCYNNWKTKEGRPKCP
  • 2. L06AT00238    From 1 To 66 E-value: 1e-32 Score: 130
        GKLKPQQCNSKCSFRCSATSHKKPCMFFCLKCCKKCLCVPPGTFGNKQTCPCYNNWKTKEGRPKCP
  • 3. L06AT00242    From 1 To 66 E-value: 2e-32 Score: 129
        GKLKPQQCNSKCSYRCSATSHKKPCMFFCLKCCKKCLCVPPGTFGNKQTCPCYNNWKTKEGRPKCP
  • 4. L01A000882    From 32 To 97 E-value: 3e-27 Score: 112
        GTLRPSDCKPKCTYRCSATSHKKPCMFFCQKCCAKCLCVPPGTYGNKQICPCYNSWKTKEGGPKCP
  • 5. L01A000863    From 10 To 75 E-value: 4e-27 Score: 112
        GSLRPSECGQRCSYRCSATSHKKPCMFFCQKCCAKCLCVPPGTFGNKQVCPCYNNWKTQQGGPKCP

Structure

  •   Domains
  •   1  Name:GASA    Interpro Link:IPR003854
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Unseld M.,Ansorge W.,Rieger M.,Lemcke K.,Salanoubat M.,
  •   Title:Sequence and analysis of chromosome 3 of the plant Arabidopsis thaliana.
  •   Journal:Nature, 2000, 408, 820-822  [MEDLINE:21016720]
  •   [2]  Shinn P.,Chen H.,Dale J.M.,Lim J.,Yamada K.,
  •   Title:Empirical analysis of transcriptional activity in the Arabidopsis genome.
  •   Journal:Science, 2003, 302, 842-846  [MEDLINE:22954850]
  •   [3]  Wang X.,Sun S.,Peng J.,Yang C.,Zhang S.,
  •   Title:GASA5, a regulator of flowering time and stem growth in Arabidopsis thaliana.
  •   Journal:Plant Mol. Biol., 2009, 69, 745-759  [PubMed:19190987]
  •   [4]  Wang X.,Zhang S.,
  •   Title:Overexpression of GASA5 increases the sensitivity of Arabidopsis to heat stress.
  •   Journal:J. Plant Physiol., 2011, 168, 2093-2101  [PubMed:21835493]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: